Drosophila melanogaster (fruit fly): Dmel_CG7425 Help Entry Dmel_CG7425       CDS       T00030                                  Symbol eff Name (RefSeq) effete, isoform B   KO K06689   ubiquitin-conjugating enzyme E2 D [EC:2.3.2.23] Organism dme  Drosophila melanogaster (fruit fly) Pathway dme03083   Polycomb repressive complex dme04013   MAPK signaling pathway - fly dme04120   Ubiquitin mediated proteolysis dme04141   Protein processing in endoplasmic reticulum dme04624   Toll and Imd signaling pathway Brite KEGG Orthology (KO) [BR:dme00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     Dmel_CG7425 (eff)    04120 Ubiquitin mediated proteolysis     Dmel_CG7425 (eff)   09126 Chromosome    03083 Polycomb repressive complex     Dmel_CG7425 (eff)  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     Dmel_CG7425 (eff)  09150 Organismal Systems   09151 Immune system    04624 Toll and Imd signaling pathway     Dmel_CG7425 (eff)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:dme04121]     Dmel_CG7425 (eff) Enzymes [BR:dme01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.23  E2 ubiquitin-conjugating enzyme      Dmel_CG7425 (eff) Ubiquitin system [BR:dme04121]  Ubiquitin-conjugating enzymes (E2)   Ubiquitin-conjugating enzymes    Dmel_CG7425 (eff) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  UQ_con RWD UEV UBC_like Motif Other DBs NCBI-GeneID:  41785 NCBI-ProteinID:  NP_001262578 FlyBase:  FBgn0011217 UniProt:  P25867 A0A0B4KHJ1 LinkDB All DBs Position 3R Genome browser AA seq 147 aa AA seqDB search MALKRINKELQDLGRDPPAQCSAGPVGDDLFHWQATIMGPPDSPYQGGVFFLTIHFPTDY PFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLV PEIARIYKTDREKYNELAREWTRKYAM NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atggcgttaaaaagaatcaataaggaactgcaagatctgggcagagatccacctgcacaa tgttcagccggtccagttggagatgatttatttcactggcaagctacaataatgggcccg ccggacagcccttatcaaggaggtgtattcttcttaactatacattttccaacagactat ccctttaaaccacccaaagtggcttttacaacgcgcatataccatccaaacatcaacagc aatggatcgatttgtctcgatatattaagatctcagtggtcgccagcattaactatttca aaagttttattatcaatttgctctctactctgtgatcccaatccagacgatcctcttgtt ccagagattgccagaatatataaaaccgatcgggaaaaatacaatgagctggcacgagag tggactagaaagtatgctatgtga

DBGET integrated database retrieval system