KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7793
Entry
Dmel_CG7793       CDS       T00030                                 

Gene name
Sos
Definition
(RefSeq) Son of sevenless
  KO
K03099  son of sevenless
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04013  MAPK signaling pathway - fly
dme04068  FoxO signaling pathway
dme04150  mTOR signaling pathway
dme04320  Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG7793 (Sos)
   04068 FoxO signaling pathway
    Dmel_CG7793 (Sos)
   04150 mTOR signaling pathway
    Dmel_CG7793 (Sos)
 09150 Organismal Systems
  09158 Development and regeneration
   04320 Dorso-ventral axis formation
    Dmel_CG7793 (Sos)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:dme04990]
    Dmel_CG7793 (Sos)
Domain-containing proteins not elsewhere classified [BR:dme04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   Dmel_CG7793 (Sos)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH IQ_SEC7_PH
Other DBs
NCBI-GeneID: 34790
NCBI-ProteinID: NP_476597
FlyBase: FBgn0001965
UniProt: P26675
LinkDB
Position
2L
AA seq 1596 aa
MFSGPSGHAHTISYGGGIGLGTGGGGGSGGSGSGSQGGGGGIGIGGGGVAGLQDCDGYDF
TKCENAARWRGLFTPSLKKVLEQVHPRVTAKEDALLYVEKLCLRLLAMLCAKPLPHSVQD
VEEKVNKSFPAPIDQWALNEAKEVINSKKRKSVLPTEKVHTLLQKDVLQYKIDSSVSAFL
VAVLEYISADILKMAGDYVIKIAHCEITKEDIEVVMNADRVLMDMLNQSEAHILPSPLSL
PAQRASATYEETVKELIHDEKQYQRDLHMIIRVFREELVKIVSDPRELEPIFSNIMDIYE
VTVTLLGSLEDVIEMSQEQSAPCVGSCFEELAEAEEFDVYKKYAYDVTSQASRDALNNLL
SKPGASSLTTAGHGFRDAVKYYLPKLLLVPICHAFVYFDYIKHLKDLSSSQDDIESFEQV
QGLLHPLHCDLEKVMASLSKERQVPVSGRVRRQLAIERTRELQMKVEHWEDKDVGQNCNE
FIREDSLSKLGSGKRIWSERKVFLFDGLMVLCKANTKKQTPSAGATAYDYRLKEKYFMRR
VDINDRPDSDDLKNSFELAPRMQPPIVLTAKNAQHKHDWMADLLMVITKSMLDRHLDSIL
QDIERKHPLRMPSPEIYKFAVPDSGDNIVLEERESAGVPMIKGATLCKLIERLTYHIYAD
PTFVRTFLTTYRYFCSPQQLLQLLVERFNIPDPSLVYQDTGTAGAGGMGGVGGDKEHKNS
HREDWKRYRKEYVQPVQFRVLNVLRHWVDHHFYDFEKDPMLLEKLLNFLEHVNGKSMRKW
VDSVLKIVQRKNEQEKSNKKIVYAYGHDPPPIEHHLSVPNDEITLLTLHPLELARQLTLL
EFEMYKNVKPSELVGSPWTKKDKEVKSPNLLKIMKHTTNVTRWIEKSITEAENYEERLAI
MQRAIEVMMVMLELNNFNGILSIVAAMGTASVYRLRWTFQGLPERYRKFLEECRELSDDH
LKKYQERLRSINPPCVPFFGRYLTNILHLEEGNPDLLANTELINFSKRRKVAEIIGEIQQ
YQNQPYCLNEESTIRQFFEQLDPFNGLSDKQMSDYLYNESLRIEPRGCKTVPKFPRKWPH
IPLKSPGIKPRRQNQTNSSSKLSNSTSSVAAAAAASSTATSIATASAPSLHASSIMDAPT
AAAANAGSGTLAGEQSPQHNPHAFSVFAPVIIPERNTSSWSGTPQHTRTDQNNGEVSVPA
PHLPKKPGAHVWANNNSTLASASAMDVVFSPALPEHLPPQSLPDSNPFASDTEAPPSPLP
KLVVSPRHETGNRSPFHGRMQNSPTHSTASTVTLTGMSTSGGEEFCAGGFYFNSAHQGQP
GAVPISPHVNVPMATNMEYRAVPPPLPPRRKERTESCADMAQKRQAPDAPTLPPRDGELS
PPPIPPRLNHSTGISYLRQSHGKSKEFVGNSSLLLPNTSSIMIRRNSAIEKRAAATSQPN
QAAAGPISTTLVTVSQAVATDEPLPLPISPAASSSTTTSPLTPAMSPMSPNIPSHPVEST
SSSYAHQLRMRQQQQQQTHPAIYSQHHQHHATHLPHHPHQHHSNPTQSRSSPKEFFPIAT
SLEGTPKLPPKPSLSANFYNNPDKGTMFLYPSTNEE
NT seq 4791 nt   +upstreamnt  +downstreamnt
atgttctcggggcccagcggccatgcccacaccattagctacgggggcgggatcggtctg
ggcactggaggcggcggcggcagcggtggtagtggtagtggctcacagggcggaggcggt
ggtattggcattggcggcggtggcgtggctgggctgcaggattgcgatggctatgacttc
accaagtgcgagaatgctgcgagatggaggggcttgtttacgccatcgctaaagaaggtg
ctggagcaagtgcatccacgggttaccgccaaggaggacgcactgctgtatgtggagaaa
ctctgtctgcggcttctggccatgctgtgcgccaagccgctgccccattccgtgcaggat
gtggaggagaaggtgaacaagtcctttccagcgcccatcgatcagtgggccctgaacgag
gccaaggaggtgatcaactcgaagaaacgcaagtctgtcctgcccacggaaaaggtgcac
acgctgctccagaaggatgtgttgcagtacaagatcgatagctccgtgtccgccttcctg
gtggccgtgctcgagtacatctcagcggacatactcaaaatggccggcgactatgtgatc
aagatcgcccactgcgagatcaccaaggaggacatcgaggtggtgatgaacgccgatcgt
gtgctaatggacatgctcaaccagagcgaagcccacatcctgcccagtcccctgtcactt
cccgcgcagcgtgcaagtgccacctacgaggagacggtcaaggagctgatccacgacgag
aagcagtaccaacgcgacctgcacatgatcatacgcgtctttcgtgaggagctggtgaag
atcgtgtccgatccgcgcgagctggaaccgatattctccaacataatggacatttacgag
gtgacggtcactctgctcggctccctggaggacgtcatcgagatgtcccaggagcagagt
gccccctgcgtcggtagctgctttgaggaactggccgaggccgaggagttcgatgtgtac
aagaagtacgcctacgacgttacctcgcaggcctcacgggatgctctcaacaatctcctg
tctaagccaggggcctcatctctgaccacagccggccatggcttccgcgatgcggtcaaa
tactatttgcccaagctgcttctggtgcccatttgccatgccttcgtgtatttcgactac
atcaagcatctcaaggatctcagctcttcgcaggacgacatcgagagcttcgaacaggta
cagggactgttgcatccactccactgcgatctcgaaaaggtaatggccagcctgtccaag
gagcgacaagttccggttagcggtcgagtgcgccgccagctggcaatcgagcggacacgg
gagctccaaatgaaggtggagcactgggaggacaaggacgtgggccagaattgcaatgaa
tttattcgcgaggattcgctgagcaaacttggatcgggaaaacgaatctggagcgagcgc
aaggtattcctcttcgacgggctaatggtgctatgcaaggcaaacaccaagaaacaaaca
ccatcggcaggagcaacggcctacgactaccgactgaaggagaagtatttcatgcgacgc
gtggatatcaacgatcgaccggacagcgatgatctgaagaacagttttgagttggcaccc
cggatgcagccgcccattgtgctgaccgccaagaatgcacagcacaagcacgactggatg
gcagacctgctgatggttatcaccaagtcgatgctggaccggcacttggacagcatattg
caagacatcgagcgaaagcatccgctgcggatgcccagtccggagatttacaagttcgcg
gtgccggacagcggtgacaatatcgtgttggaggagcgcgaaagcgcaggagtgccgatg
atcaagggagcgacgctttgcaagctaatcgagcgcctcacctatcacatctacgccgat
ccgacttttgtgcgcaccttcctcaccacatatcgctacttctgctcgccgcagcaattg
ctgcaactgctggtggaacgctttaacataccggatcccagcctggtctatcaagacacg
ggcacagcaggtgcgggtggaatgggcggcgttggcggtgacaaggagcacaagaactcg
catcgcgaggactggaaacgatatcgcaaggagtacgtgcagccagtgcagtttcgagtg
ctcaacgtactgcgccattgggtcgaccatcatttttacgatttcgagaaggatcccatg
ttgctggagaagctgctgaactttctggagcacgtgaatggcaaatcgatgcgcaagtgg
gtggattccgtgcttaagattgttcagagaaagaacgagcaggagaaaagcaataaaaag
attgtatacgcctatggccacgatccgccgcccattgagcatcaccttagtgtacccaac
gacgagataacgctcctcaccctgcacccactggaactggcccgtcagctcactctactg
gaattcgagatgtacaagaatgtaaagccgtctgagttggtcggatcaccctggacgaaa
aaggacaaggaggtgaagagccctaatctactgaagataatgaagcacaccacgaacgtc
acccgctggattgaaaaatccatcaccgaagcggagaactacgaggaacgcctggctatt
atgcaacgcgcaatcgaagtgatgatggtgatgctggaattgaacaattttaatggaatc
ctctcgattgtcgcggctatgggcacggcatctgtttatcgactgcggtggacattccag
ggattgcccgaacgctacagaaaattcttggaggaatgccgcgagctcagcgacgatcat
ctcaaaaagtatcaggagcgattgcgatccatcaatccgccttgtgtgccatttttcggt
cgctacttgaccaacatactccacttggaggagggtaaccccgacctgctagccaacaca
gagctaattaacttttccaaacgacggaaagtggccgagattattggcgagattcaacag
taccagaaccagccatactgcctcaacgaggagtccacaatacgacagttcttcgagcaa
ctggatccgtttaacggactgtccgacaaacagatgtccgactatctctataacgaaagc
ctgcgcattgagccaaggggctgcaagacagtgccgaaattccctcgaaaatggccgcac
attccgctcaaatcgccgggcatcaagccgcgtcgccagaatcagaccaacagcagtagc
aagctgtcgaacagcacgtcgtccgtggcggcggcagcggcagcatcgtcaacggccacc
tcaatagctacggcatcggcgccatctttgcacgcctccagcataatggatgcgccaaca
gcagcagcagctaatgctggatctggaactctcgctggcgagcaaagtccgcagcacaat
ccgcacgctttctccgttttcgcccctgttattatacccgaacggaacaccagcagctgg
agtggaacgccacagcacactcgaacggaccagaacaacggggaggtttcggtgccggcg
ccacatctccccaagaaaccgggcgcgcatgtctgggctaacaacaactcgacactggcc
agtgcgtcggcaatggatgttgtgttcagtccagcgctgccggagcatctgccaccgcag
tccctgccggacagcaatccattcgcatcggacacggaagctccaccgtcgccgctgccc
aagctagtggtcagtccgcgtcacgaaaccggcaatcgatcaccattccatgggcgcatg
cagaacagcccaacgcatagcactgccagtaccgtgacccttacaggcatgtctacatcg
ggcggggaggaattctgcgcgggtggattctactttaacagtgcccatcagggacagccg
ggggcagtgcccatctcgccgcatgtcaacgttccgatggccaccaatatggagtaccga
gcagtgccgcctccactgccacccagacgcaaggagcgcactgagagctgtgcggacatg
gcgcaaaagcgtcaggcgccagacgcacccacattacccccgcgtgatggcgaactcagt
ccgccgccgataccgccacggctcaaccattccacgggcatcagctacttgcgacaaagc
cacggcaagagcaaggagtttgtgggcaacagcagtctgctcctgcccaacaccagcagt
attatgatacgccgcaactcggcgatcgagaagcgggcagcggcaactagccagccaaac
caggcggcggcgggacccatcagcacgacactagtgaccgtgtcgcaggcagtggcgacg
gacgaaccgctgccgctaccgatctcgccagcggcaagctcctcgacgaccacatcaccg
ctgacacccgccatgtcgcccatgtctcccaacattcccagccatccggtggagagcacg
tcgagcagctatgcccaccaactgcgaatgcggcagcagcagcagcagcagacgcatcca
gcgatctactcgcagcaccatcaacatcatgccacccatctgccgcaccatccgcaccag
caccattcgaatccgacgcagtcgcgctcgtcccccaaggagttctttccgattgccacg
agcctcgagggcacacccaaacttccaccaaaacctagtctaagcgctaacttctataac
aatccagataaaggtacgatgtttctttacccaagtacaaacgaagaataa

DBGET integrated database retrieval system