Drosophila melanogaster (fruit fly): Dmel_CG8287 Help Entry Dmel_CG8287       CDS       T00030                                  Symbol Rab8 Name (RefSeq) Rab8, isoform B   KO K07901   Ras-related protein Rab-8A Organism dme  Drosophila melanogaster (fruit fly) Pathway dme04140   Autophagy - animal dme04144   Endocytosis Brite KEGG Orthology (KO) [BR:dme00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     Dmel_CG8287 (Rab8)    04140 Autophagy - animal     Dmel_CG8287 (Rab8)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dme04131]     Dmel_CG8287 (Rab8)    03036 Chromosome and associated proteins [BR:dme03036]     Dmel_CG8287 (Rab8)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dme04147]     Dmel_CG8287 (Rab8)    04031 GTP-binding proteins [BR:dme04031]     Dmel_CG8287 (Rab8) Membrane trafficking [BR:dme04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     Dmel_CG8287 (Rab8)  Autophagy   Other autophagy associated proteins     Dmel_CG8287 (Rab8) Chromosome and associated proteins [BR:dme03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     Dmel_CG8287 (Rab8) Exosome [BR:dme04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Dmel_CG8287 (Rab8)   Exosomal proteins of other body fluids (saliva and urine)    Dmel_CG8287 (Rab8)   Exosomal proteins of colorectal cancer cells    Dmel_CG8287 (Rab8) GTP-binding proteins [BR:dme04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     Dmel_CG8287 (Rab8) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU YhaZ_C DUF3963 Motif Other DBs NCBI-GeneID:  40168 NCBI-ProteinID:  NP_001246836 FlyBase:  FBgn0262518 UniProt:  M9NEE8 LinkDB All DBs Position 3L:complement(19867488..19871078) Genome browser AA seq 172 aa AA seqDB search MGSDQTGIDFKIRTIELDNKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITQEKS FENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVSKERGEQLAIEYGIKFMETSAKAS INVEEAFLTLASDIKAKTEKRMEANNPPKGGHQLKPMDSRTKDSWLSRCSLL NT seq 519 nt NT seq  +upstreamnt  +downstreamnt atgggttccgaccaaacaggtatcgattttaaaattagaacaattgaattagataacaag aagattaagctgcagatatgggacactgccggccaggagcgttttcgcacaatcaccacg gcctattacagaggtgccatgggcatcatgctggtatatgacataacccaagaaaagtcc ttcgagaacatcaaaaactggatcaggaatatcgaggaaaatgcgtccgccgatgtcgag aaaatgctgctgggaaacaagtgcgaattgaccgataagcgacaggtttcaaaagagcgc ggcgaacaattggccatcgagtatggcatcaagttcatggagacctccgcgaaggccagc attaacgtggaagaagccttcctcaccctagccagtgatatcaaagcgaaaacggaaaag cgaatggaggcgaacaacccacccaagggcggccatcagctgaaaccgatggacagtcgg acgaaggacagttggttgtccaggtgcagtctgctttga

DBGET integrated database retrieval system