KEGG   Drosophila melanogaster (fruit fly): Dmel_CG8727
Entry
Dmel_CG8727       CDS       T00030                                 
Symbol
cyc
Name
(RefSeq) cycle
  KO
K02296  aryl hydrocarbon receptor nuclear translocator-like protein 1
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04711  Circadian rhythm - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04711 Circadian rhythm - fly
    Dmel_CG8727 (cyc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dme03000]
    Dmel_CG8727 (cyc)
Transcription factors [BR:dme03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    Dmel_CG8727 (cyc)
SSDB
Motif
Pfam: PAS_11 PAS_3 HLH PAS PAS_9 PAS_4 PAS_2
Other DBs
NCBI-GeneID: 40162
NCBI-ProteinID: NP_524168
FlyBase: FBgn0023094
UniProt: O61734
Structure
LinkDB
Position
3L
AA seq 413 aa
MEVQEFCENMEEIEDENYDEEKSARTSDENRKQNHSEIEKRRRDKMNTYINELSSMIPMC
FAMQRKLDKLTVLRMAVQHLRGIRGSGSLHPFNGSDYRPSFLSDQELKMIILQASEGFLF
VVGCDRGRILYVSDSVSSVLNSTQADLLGQSWFDVLHPKDIGKVKEQLSSLEQCPRERLI
DAKTMLPVKTDVPQSLCRLCPGARRSFFCRMKLRTASNNQIKEESDTSSSSRSSTKRKSR
LTTGHKYRVIQCTGYLKSWTPIKDEDQDADSDEQTTNLSCLVAIGRIPPNVRNSTVPASL
DNHPNIRHVLFISRHSGEGKFLFIDQRATLVIGFLPQEILGTSFYEYFHNEDIAALMESH
KMVMQVPEKVTTQVYRFRCKDNSYIQLQSEWRAFKNPWTSEIDYIIAKNSVFL
NT seq 1242 nt   +upstreamnt  +downstreamnt
atggaagttcaggagttctgcgaaaatatggaggagatcgaagatgaaaactacgacgag
gagaagtcagctagaacctcggatgaaaatcgcaagcaaaatcacagcgagatcgagaag
cggcgtcgggacaagatgaacacgtacatcaacgagctctcctccatgattcccatgtgc
tttgcgatgcagcgaaagctggacaaactgactgtgctccggatggcagtgcagcatctg
cgagggatccgtggcagcggcagcttacatccattcaacggatccgattaccggcctagc
ttcctgtccgaccaggagctcaagatgattatcctgcaagcgtcggagggattcctgttc
gtggtgggttgtgaccgaggacgcatcctgtacgtttccgattcggtgtccagtgtgctg
aacagcacccaagcggacctgctgggacagagctggttcgacgtcctgcatccgaaggac
ataggcaaggttaaggagcagctatcctcactggaacagtgtcccagggaaaggcttatc
gatgcgaagaccatgttgcccgttaagaccgacgttccacagagcttgtgccgcctgtgt
ccgggtgcccggcgctccttcttctgccgcatgaagctgcgcactgccagcaacaaccag
atcaaggaggagtccgatacgtcctccagctcccggagctccacgaagcgcaagtccaga
ctgactacgggccacaagtaccgggttatccagtgcacgggctacctcaagtcctggaca
cccatcaaggacgaggaccaggacgccgacagcgacgagcaaacaacgaatctatcctgc
cttgtggcaattggtcgcattccgcccaacgttcgcaactccacagtacccgcctcgctg
gacaatcacccgaacatacggcacgtgctcttcatctcgcgccactccggcgagggcaag
ttcctgttcatagaccagcgtgccaccctcgtgattggtttcctgcctcaggagatcctc
ggcaccagcttctacgagtacttccacaacgaagacatcgctgcgctgatggagtctcac
aagatggtgatgcaggtgccggaaaaggtgaccactcaggtctaccgcttccggtgcaag
gacaacagctacattcagctgcagagcgagtggcgggccttcaagaatccctggacgagc
gagattgactatataatcgccaagaattccgtgttcttataa

DBGET integrated database retrieval system