KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9211
Entry
Dmel_CG9211       CDS       T00030                                 

Gene name
ihog
Definition
(RefSeq) interference hedgehog
  KO
K20244  interference hedgohog
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04341  Hedgehog signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04341 Hedgehog signaling pathway - fly
    Dmel_CG9211 (ihog)
SSDB
Motif
Pfam: Ig_3 I-set ig Ig_2 fn3 V-set Ig_6 Ig_4 Pur_ac_phosph_N DUF4670 Shisa Herpes_gE C2-set_2 DUF6259 Aconitase_2_N
Other DBs
NCBI-GeneID: 33972
NCBI-ProteinID: NP_609085
FlyBase: FBgn0031872
UniProt: Q9VM64
LinkDB
Structure
PDB: 
2IC2 2IBG 2IBB

Position
2L
AA seq 886 aa
MTLLTSSLLLFSLLTSRLEAIPVLEKSPAHPAHSAHPAHPAHPAHPAHPSPGVRILRAPE
SLVAPLGDEVVLECETSLQPERFEWSHRSSRSPGAGFKYLKTGTAKANVSQEAAISRLRV
LVRPDTLGEYRCVGWFGPLVVTSTIARLELASTSLVDAQESESPLQWRVSAGNSVLWSCG
QQVQSNPSASWSYYRNGVEIKPEFIGTNGNLFLSNVSSESSGSYSCQATNPASGERIQLP
GSLQLQVTPEQRSESKSPHLLRGQPSSQEITIREGSSLLLLCPGVGSPPPTVVWSSPDVV
GAVKNKRSKVFGHALEISNTRVNDAGTYICFQDNGVRPALEHYIKVHVEQPPQIVRPPWA
DLTNEGDRLKLECKATGVPTPEIYWLLNGHSSIDDSEAELSNNFLILHSVLKRHAGYVQC
FARNRLGEHSAGTLLQVNPKQIQEPRESGGTHRPKPNQGSRQKQMYPPTPPNVTRLSDES
VMLRWMVPRNDGLPIVIFKVQYRMVGKRKNWQTTNDNIPYGKPKWNSELGKSFTASVTDL
KPQHTYRFRILAVYSNNDNKESNTSAKFYLQPGAALDPMPVPELLEIEEYSETAVVLHWS
LASDADEHLITGYYAYYRPSSSAGEYFKATIEGAHARSFKIAPLETATMYEFKLQSFSAA
SASEFSALKQGRTQRPKTSTTEEPTLQMGDRDTTTPSHNETFNMSPMLTGTIGGGAVLIL
LLISTCFCVCRRRNSRSRGNNPNKPRMAELRDDFVPLGNCSPTKQRQRTRHIHITLNPLA
QQQQQALEEKNDTDQDAPYYQRPSSYDYDPTLRRMSSSSLRRSQRTLERAGGSNGSNNGN
NNNLNQSAEAGSIENPGKPGRVLMKRPRLSSRSENLSSGSLNSVGV
NT seq 2661 nt   +upstreamnt  +downstreamnt
atgacgctgctcacatcctcgctgctgctcttttcgctgctgacgtcgcggctcgaagca
attccggttttggagaagtcccccgcccatcctgcccactctgcacatcccgcacatccc
gcacatcccgcacatcccgcgcatccatcgcctggcgtgcgaattcttcgcgcacccgaa
tctttggtggcgcccctgggagacgaggtggtgctggagtgcgagaccagtttgcagcca
gagcgcttcgaatggagccaccggtccagcagatctccgggagcggggttcaagtacctt
aagacaggcacggccaaagcgaatgtctcccaggaggcggccatctcgcgactgagggtg
ctcgtccgaccagacactctaggcgagtaccgatgcgttggctggttcggtccgctggtg
gtcacgtctaccattgctcgattggagctggccagcactagcctggtggacgctcaggaa
tcggaatcacccctccaatggcgggtgtctgctggaaactctgtgctctggtcctgcgga
caacaggtgcaatcgaatccatctgccagttggtcctactatcgaaacggagtggaaatc
aaaccggagttcatcggaaccaatggaaatctttttctaagcaatgtatcctccgagtcg
tcaggcagctattcctgccaggcaaccaatcctgcctctggcgagagaattcagctgccc
ggctcgctgcaactacaggttacaccagagcagaggtcggagagtaaatctccacacttg
ctcaggggacagccgagctcccaagaaattaccatacgcgaagggagttcgctgttgctg
ctgtgtcctggagttggctcaccgccaccgacggttgtctggagcagtcccgatgtcgtg
ggagctgttaagaacaagcgttcgaaagtatttggacacgctttggagatatccaacacc
cgagttaatgatgctggcacctatatttgctttcaagataatggagtgcggcctgcgtta
gaacactacataaaagtgcatgtcgagcagccgcctcagattgtgcgaccaccctgggcc
gatcttaccaacgagggcgatcgtttgaagttggagtgtaaggccacaggagtgccaacg
ccagagatctactggctgctgaacggtcacagcagcatcgatgattctgaggctgagctc
tccaataatttcctgatattgcacagcgtcttgaagcgtcatgcgggctatgtccaatgc
tttgcacgaaacagacttggtgagcacagtgcgggtacactgctgcaggtgaatcccaag
cagattcaggaaccccgggaatcggggggtacacacaggcccaagcccaatcagggttcc
aggcagaagcagatgtatccaccgactcctccaaatgtaacccgacttagcgatgaatcc
gtaatgttgcgctggatggtgccccgaaacgatgggttaccaattgtcatttttaaggtt
cagtaccgcatggttggcaagcgcaagaactggcagacaaccaacgataatataccgtat
ggaaaaccgaagtggaactccgagctgggcaagagcttcacggcttcggtgacggacctg
aagcctcagcacacctatcgtttccgcatcctagccgtttactccaacaatgacaataag
gaaagtaatacctcggcgaaattttacctgcagccaggtgcagcacttgatccgatgccg
gtgccagagcttctggagatcgaggaatactctgaaaccgctgtggtgctgcactggagt
ctagccagcgatgcggatgaacacctgatcactggctactacgcctactatcgaccctcg
tcctcggcaggggaatatttcaaggcaaccattgaaggagcccatgctagaagctttaaa
atagcacccctcgagacggccaccatgtacgagttcaagttgcagtccttcagtgccgcc
tctgcatccgaatttagtgcccttaagcaggggcgcacccaacgtcccaaaaccagcacc
acagaggagccaacactgcaaatgggcgaccgcgatacaacaactcccagtcataacgag
acattcaatatgagtcccatgctgacgggaacaatcggcggcggggcagtgctcattctg
cttctgattagcacctgtttctgtgtttgccggcgtaggaattccagaagccggggaaac
aatccaaacaagccacggatggcggagctgagagatgactttgtgccgctgggcaactgc
tcgcccaccaagcagcgccagcgaacacgacacatccacataaccttgaatccactcgcc
cagcagcagcagcaggcgctggaggagaagaatgacacagaccaggatgcgccctattat
cagcggccgtcgagctatgactacgatcccacgctgcgcaggatgtcctcctcctcgctg
cgtcgctcacaacgcacgctggaacgtgctggcggcagcaatggctccaacaacggcaac
aacaacaatctaaatcaatccgcagaggcgggttccatcgaaaatcccggcaagccgggt
cgtgtactcatgaaacgcccccgtctgtccagtcgctccgagaacctctcctccggcagc
ctcaacagcgttggcgtgtaa

DBGET integrated database retrieval system