KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9659
Entry
Dmel_CG9659       CDS       T00030                                 

Gene name
egh
Definition
(RefSeq) egghead, isoform D
  KO
K02359  beta-1,4-mannosyltransferase [EC:2.4.1.-]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04320  Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dme00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04320 Dorso-ventral axis formation
    Dmel_CG9659 (egh)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dme01003]
    Dmel_CG9659 (egh)
Enzymes [BR:dme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     Dmel_CG9659 (egh)
Glycosyltransferases [BR:dme01003]
 Glycan extension
  Glycolipid
   Dmel_CG9659 (egh)
SSDB
Motif
Pfam: Glyco_trans_2_3 RMF
Other DBs
NCBI-GeneID: 31239
NCBI-ProteinID: NP_001284829
FlyBase: FBgn0001404
UniProt: O01346 A4V3W0
LinkDB
Position
X
AA seq 457 aa
MNSTTKHLLHCTLLITVIVTFEVFSGGIKIDENSFTLVDPWTEYGQLATVLLYLLRFLTL
LTLPQVLFNFCGLVFYNAFPEKVVLKGSPLLAPFICIRVVTRGDFPDLVKTNVLRNMNTC
LDTGLENFLIEVVTDKAVNLSQHRRIREIVVPKEYKTRTGALFKSRALQYCLEDNVNVLN
DSDWIVHLDEETLLTENSVRGIINFVLDGKHPFGQGLITYANENVVNWLTTLADSFRVSD
DMGKLRLQFKLFHKPLFSWKGSYVVTQVSAERSVSFDNGIDGSVAEDCFFAMRAFSQGYT
FNFIEGEMYEKSPFTLLDFLQQRKRWLQGILLVVHSKMIPFKHKLLLGISVYSWVTMPLS
TSNIIFAALYPIPCPNLVDFVCAFIAAINIYMYVFGVIKSFSLYRFGLFRFLACVLGAVC
TIPVNVVIENVAVIWGLVGKKHKFYVVQKDVRVLETV
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgaactccaccacaaagcatctgctgcactgcacactgctcatcactgtgatagttacc
ttcgaagtattctccggcggtattaagattgacgagaactcgttcacgctcgtggatcct
tggactgaatacggccaattggccacggttctgctgtacttattgcgctttctcacgctg
ctcacgctgccccaggtgctgttcaatttctgcggcctggtattctacaatgccttcccc
gagaaggtcgtcctcaagggcagccccctgctggcgcccttcatctgcatccgtgtggtc
acgcgcggcgacttcccggatttggttaagacgaatgtgctgcgcaacatgaacacctgc
ctagacacgggactggagaactttctcatcgaagtggtcacggacaaggcggtgaatctg
tcacagcatcgacgcatccgagagatcgttgtgcccaaggagtacaagacgagaaccggg
gcgttgttcaagtcgcgtgccctgcagtattgcctggaggataatgtgaacgtgctgaac
gacagcgactggatcgtccatctggatgaggagacgctgctcacggagaattcggtgcgt
ggtatcattaactttgtgctggatggcaagcacccgttcggccagggcctgatcacctat
gccaacgagaacgtggtcaattggctgaccacattggcggacagctttcgggtctccgat
gatatgggcaagctgcgtctgcagttcaagctctttcacaagccgctcttcagctggaag
ggcagttatgtggtcacccaggtgagtgctgagcgttcagtgtcctttgacaacggaatc
gacggttcggtggccgaggattgcttcttcgcgatgcgggcctttagccagggctacacg
ttcaacttcatcgagggcgaaatgtacgagaagtcgccgttcacgctgctggacttcctg
cagcagaggaaacgatggctccagggcattctgctggtggtccactccaagatgatcccg
tttaagcacaagctcctgctgggcatcagtgtctattcgtgggtcaccatgccgctgtcc
acgtcgaacatcatctttgcggcactgtatcccattccctgcccaaatctggttgacttt
gtgtgcgccttcatcgcggccattaatatctacatgtacgtctttggcgtaatcaagtcc
ttttcactgtaccgcttcggtttgttccgattcctggcctgcgtgctgggtgcggtgtgc
acgatacccgtgaatgtggttatcgagaatgtggctgtcatttggggcctggtgggcaag
aagcacaagttctatgtggttcagaaggatgtgcgcgtactggagactgtctag

DBGET integrated database retrieval system