Drosophila melanogaster (fruit fly): Dmel_CG9920 Help Entry Dmel_CG9920       CDS       T00030                                  Symbol CG9920 Name (RefSeq) uncharacterized protein   KO K04078   chaperonin GroES Organism dme  Drosophila melanogaster (fruit fly) Brite KEGG Orthology (KO) [BR:dme00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:dme03110]     Dmel_CG9920 (CG9920)    03029 Mitochondrial biogenesis [BR:dme03029]     Dmel_CG9920 (CG9920) Chaperones and folding catalysts [BR:dme03110]  Heat shock proteins   HSP10    Dmel_CG9920 (CG9920) Mitochondrial biogenesis [BR:dme03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     Dmel_CG9920 (CG9920) SSDB OrthologParalogGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-GeneID:  41712 NCBI-ProteinID:  NP_650333 FlyBase:  FBgn0038200 UniProt:  Q9VFN5 Q7JYP0 LinkDB All DBs Position 3R Genome browser AA seq 102 aa AA seqDB search MSNVIKKVIPMLDRILIQRFEVKTTTAGGILLPEESVPKEMQGVVVAVGPGARNPAGAGH LSVGVKEGDRVLLPKYGGTKVDMDDKREYVLFRESDILAKLE NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgtccaacgttattaagaaggtgattcccatgctggaccgcattctaatccagcgtttc gaggtgaagaccaccaccgcgggcggcatcctgctgcccgaggagtcggtgcccaaggag atgcagggcgtggtggttgccgtcggacccggagcccgcaatcctgctggagctggacac ttgtccgttggcgtcaaggagggcgatcgcgtgctgttgcccaaatacggtggaactaag gtcgatatggacgacaagcgcgagtatgttctgttccgcgagagcgatatccttgctaaa ctggaatag

DBGET integrated database retrieval system