KEGG   Dipodomys merriami (Merriam's kangaroo rat): 138803942
Entry
138803942         CDS       T11079                                 
Name
(RefSeq) calmodulin-like
  KO
K02183  calmodulin
Organism
dmer  Dipodomys merriami (Merriam's kangaroo rat)
Pathway
dmer04014  Ras signaling pathway
dmer04015  Rap1 signaling pathway
dmer04020  Calcium signaling pathway
dmer04022  cGMP-PKG signaling pathway
dmer04024  cAMP signaling pathway
dmer04070  Phosphatidylinositol signaling system
dmer04114  Oocyte meiosis
dmer04218  Cellular senescence
dmer04261  Adrenergic signaling in cardiomyocytes
dmer04270  Vascular smooth muscle contraction
dmer04371  Apelin signaling pathway
dmer04625  C-type lectin receptor signaling pathway
dmer04713  Circadian entrainment
dmer04720  Long-term potentiation
dmer04722  Neurotrophin signaling pathway
dmer04728  Dopaminergic synapse
dmer04740  Olfactory transduction
dmer04744  Phototransduction
dmer04750  Inflammatory mediator regulation of TRP channels
dmer04910  Insulin signaling pathway
dmer04912  GnRH signaling pathway
dmer04915  Estrogen signaling pathway
dmer04916  Melanogenesis
dmer04921  Oxytocin signaling pathway
dmer04922  Glucagon signaling pathway
dmer04924  Renin secretion
dmer04925  Aldosterone synthesis and secretion
dmer04970  Salivary secretion
dmer04971  Gastric acid secretion
dmer05010  Alzheimer disease
dmer05012  Parkinson disease
dmer05022  Pathways of neurodegeneration - multiple diseases
dmer05031  Amphetamine addiction
dmer05034  Alcoholism
dmer05133  Pertussis
dmer05152  Tuberculosis
dmer05163  Human cytomegalovirus infection
dmer05167  Kaposi sarcoma-associated herpesvirus infection
dmer05170  Human immunodeficiency virus 1 infection
dmer05200  Pathways in cancer
dmer05214  Glioma
dmer05417  Lipid and atherosclerosis
dmer05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dmer00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    138803942
   04015 Rap1 signaling pathway
    138803942
   04371 Apelin signaling pathway
    138803942
   04020 Calcium signaling pathway
    138803942
   04070 Phosphatidylinositol signaling system
    138803942
   04024 cAMP signaling pathway
    138803942
   04022 cGMP-PKG signaling pathway
    138803942
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    138803942
   04218 Cellular senescence
    138803942
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    138803942
  09152 Endocrine system
   04910 Insulin signaling pathway
    138803942
   04922 Glucagon signaling pathway
    138803942
   04912 GnRH signaling pathway
    138803942
   04915 Estrogen signaling pathway
    138803942
   04921 Oxytocin signaling pathway
    138803942
   04916 Melanogenesis
    138803942
   04924 Renin secretion
    138803942
   04925 Aldosterone synthesis and secretion
    138803942
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    138803942
   04270 Vascular smooth muscle contraction
    138803942
  09154 Digestive system
   04970 Salivary secretion
    138803942
   04971 Gastric acid secretion
    138803942
  09156 Nervous system
   04728 Dopaminergic synapse
    138803942
   04720 Long-term potentiation
    138803942
   04722 Neurotrophin signaling pathway
    138803942
  09157 Sensory system
   04744 Phototransduction
    138803942
   04740 Olfactory transduction
    138803942
   04750 Inflammatory mediator regulation of TRP channels
    138803942
  09159 Environmental adaptation
   04713 Circadian entrainment
    138803942
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    138803942
  09162 Cancer: specific types
   05214 Glioma
    138803942
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    138803942
   05163 Human cytomegalovirus infection
    138803942
   05167 Kaposi sarcoma-associated herpesvirus infection
    138803942
  09171 Infectious disease: bacterial
   05133 Pertussis
    138803942
   05152 Tuberculosis
    138803942
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    138803942
   05012 Parkinson disease
    138803942
   05022 Pathways of neurodegeneration - multiple diseases
    138803942
  09165 Substance dependence
   05031 Amphetamine addiction
    138803942
   05034 Alcoholism
    138803942
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    138803942
   05418 Fluid shear stress and atherosclerosis
    138803942
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dmer01009]
    138803942
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dmer04131]
    138803942
   03036 Chromosome and associated proteins [BR:dmer03036]
    138803942
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dmer04147]
    138803942
Protein phosphatases and associated proteins [BR:dmer01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     138803942
Membrane trafficking [BR:dmer04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    138803942
Chromosome and associated proteins [BR:dmer03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     138803942
Exosome [BR:dmer04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   138803942
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_9 EF-hand_8 EF-hand_5 AIF-1 CFAP251_C SAPC2_N EF-hand_FSTL1 EF_EFCAB10_C EFhand_Ca_insen EF-hand_11 DUF5580_M EH EF-hand_EFHB_C DUF3037
Other DBs
NCBI-GeneID: 138803942
NCBI-ProteinID: XP_069844275
LinkDB
Position
Unknown
AA seq 151 aa
MDAPVLTETQMAQLKKAFSLFDKDGAGVIKTRDVGTLLRSLGQNPTEAEVQDLLGQVDPD
GLGTVALPALAAVMASRGSVSVESEEEIREAFRVFDKDRSGFISAAELRQVLTTLGEKLT
DLEVDEMIREADIDGNGLLNYEEFVQMMMAK
NT seq 456 nt   +upstreamnt  +downstreamnt
atggacgcccctgtgctgaccgagacacagatggcccagctcaagaaagccttctccctg
ttcgataaagatggcgccggcgtcatcaagacccgggacgtgggcaccttgctgcggtcg
ctgggccagaaccccacggaggcggaagtgcaggacctgctgggccaggtggaccccgac
gggctgggcacggtggcgctccccgcgctggcggccgtgatggccagccggggctcggtg
tcggtggagagcgaggaggagatccgcgaggccttccgcgtcttcgacaaagaccgcagc
ggcttcatcagcgcggccgagctgcgccaagtcctgaccacgctgggggagaagctcacc
gacctggaggtggacgagatgatccgcgaggccgacatcgacggcaacggcctgctcaac
tacgaggagttcgtgcagatgatgatggccaagtga

DBGET integrated database retrieval system