KEGG   Dipodomys merriami (Merriam's kangaroo rat): 138816569
Entry
138816569         CDS       T11079                                 
Symbol
Nras
Name
(RefSeq) GTPase NRas isoform X1
  KO
K07828  GTPase NRas
Organism
dmer  Dipodomys merriami (Merriam's kangaroo rat)
Pathway
dmer01521  EGFR tyrosine kinase inhibitor resistance
dmer01522  Endocrine resistance
dmer04010  MAPK signaling pathway
dmer04012  ErbB signaling pathway
dmer04014  Ras signaling pathway
dmer04015  Rap1 signaling pathway
dmer04062  Chemokine signaling pathway
dmer04068  FoxO signaling pathway
dmer04071  Sphingolipid signaling pathway
dmer04072  Phospholipase D signaling pathway
dmer04137  Mitophagy - animal
dmer04140  Autophagy - animal
dmer04150  mTOR signaling pathway
dmer04151  PI3K-Akt signaling pathway
dmer04210  Apoptosis
dmer04211  Longevity regulating pathway
dmer04213  Longevity regulating pathway - multiple species
dmer04218  Cellular senescence
dmer04360  Axon guidance
dmer04370  VEGF signaling pathway
dmer04371  Apelin signaling pathway
dmer04540  Gap junction
dmer04550  Signaling pathways regulating pluripotency of stem cells
dmer04625  C-type lectin receptor signaling pathway
dmer04650  Natural killer cell mediated cytotoxicity
dmer04660  T cell receptor signaling pathway
dmer04662  B cell receptor signaling pathway
dmer04664  Fc epsilon RI signaling pathway
dmer04714  Thermogenesis
dmer04720  Long-term potentiation
dmer04722  Neurotrophin signaling pathway
dmer04725  Cholinergic synapse
dmer04726  Serotonergic synapse
dmer04730  Long-term depression
dmer04810  Regulation of actin cytoskeleton
dmer04910  Insulin signaling pathway
dmer04912  GnRH signaling pathway
dmer04915  Estrogen signaling pathway
dmer04916  Melanogenesis
dmer04917  Prolactin signaling pathway
dmer04919  Thyroid hormone signaling pathway
dmer04921  Oxytocin signaling pathway
dmer04926  Relaxin signaling pathway
dmer04929  GnRH secretion
dmer04933  AGE-RAGE signaling pathway in diabetic complications
dmer04935  Growth hormone synthesis, secretion and action
dmer05010  Alzheimer disease
dmer05022  Pathways of neurodegeneration - multiple diseases
dmer05034  Alcoholism
dmer05160  Hepatitis C
dmer05161  Hepatitis B
dmer05163  Human cytomegalovirus infection
dmer05165  Human papillomavirus infection
dmer05166  Human T-cell leukemia virus 1 infection
dmer05167  Kaposi sarcoma-associated herpesvirus infection
dmer05170  Human immunodeficiency virus 1 infection
dmer05200  Pathways in cancer
dmer05203  Viral carcinogenesis
dmer05205  Proteoglycans in cancer
dmer05206  MicroRNAs in cancer
dmer05207  Chemical carcinogenesis - receptor activation
dmer05208  Chemical carcinogenesis - reactive oxygen species
dmer05210  Colorectal cancer
dmer05211  Renal cell carcinoma
dmer05213  Endometrial cancer
dmer05214  Glioma
dmer05215  Prostate cancer
dmer05216  Thyroid cancer
dmer05218  Melanoma
dmer05219  Bladder cancer
dmer05220  Chronic myeloid leukemia
dmer05221  Acute myeloid leukemia
dmer05223  Non-small cell lung cancer
dmer05224  Breast cancer
dmer05225  Hepatocellular carcinoma
dmer05226  Gastric cancer
dmer05230  Central carbon metabolism in cancer
dmer05231  Choline metabolism in cancer
dmer05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dmer05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dmer00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    138816569 (Nras)
   04012 ErbB signaling pathway
    138816569 (Nras)
   04014 Ras signaling pathway
    138816569 (Nras)
   04015 Rap1 signaling pathway
    138816569 (Nras)
   04370 VEGF signaling pathway
    138816569 (Nras)
   04371 Apelin signaling pathway
    138816569 (Nras)
   04068 FoxO signaling pathway
    138816569 (Nras)
   04072 Phospholipase D signaling pathway
    138816569 (Nras)
   04071 Sphingolipid signaling pathway
    138816569 (Nras)
   04151 PI3K-Akt signaling pathway
    138816569 (Nras)
   04150 mTOR signaling pathway
    138816569 (Nras)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    138816569 (Nras)
   04137 Mitophagy - animal
    138816569 (Nras)
  09143 Cell growth and death
   04210 Apoptosis
    138816569 (Nras)
   04218 Cellular senescence
    138816569 (Nras)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    138816569 (Nras)
   04550 Signaling pathways regulating pluripotency of stem cells
    138816569 (Nras)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    138816569 (Nras)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    138816569 (Nras)
   04650 Natural killer cell mediated cytotoxicity
    138816569 (Nras)
   04660 T cell receptor signaling pathway
    138816569 (Nras)
   04662 B cell receptor signaling pathway
    138816569 (Nras)
   04664 Fc epsilon RI signaling pathway
    138816569 (Nras)
   04062 Chemokine signaling pathway
    138816569 (Nras)
  09152 Endocrine system
   04910 Insulin signaling pathway
    138816569 (Nras)
   04929 GnRH secretion
    138816569 (Nras)
   04912 GnRH signaling pathway
    138816569 (Nras)
   04915 Estrogen signaling pathway
    138816569 (Nras)
   04917 Prolactin signaling pathway
    138816569 (Nras)
   04921 Oxytocin signaling pathway
    138816569 (Nras)
   04926 Relaxin signaling pathway
    138816569 (Nras)
   04935 Growth hormone synthesis, secretion and action
    138816569 (Nras)
   04919 Thyroid hormone signaling pathway
    138816569 (Nras)
   04916 Melanogenesis
    138816569 (Nras)
  09156 Nervous system
   04725 Cholinergic synapse
    138816569 (Nras)
   04726 Serotonergic synapse
    138816569 (Nras)
   04720 Long-term potentiation
    138816569 (Nras)
   04730 Long-term depression
    138816569 (Nras)
   04722 Neurotrophin signaling pathway
    138816569 (Nras)
  09158 Development and regeneration
   04360 Axon guidance
    138816569 (Nras)
  09149 Aging
   04211 Longevity regulating pathway
    138816569 (Nras)
   04213 Longevity regulating pathway - multiple species
    138816569 (Nras)
  09159 Environmental adaptation
   04714 Thermogenesis
    138816569 (Nras)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    138816569 (Nras)
   05206 MicroRNAs in cancer
    138816569 (Nras)
   05205 Proteoglycans in cancer
    138816569 (Nras)
   05207 Chemical carcinogenesis - receptor activation
    138816569 (Nras)
   05208 Chemical carcinogenesis - reactive oxygen species
    138816569 (Nras)
   05203 Viral carcinogenesis
    138816569 (Nras)
   05230 Central carbon metabolism in cancer
    138816569 (Nras)
   05231 Choline metabolism in cancer
    138816569 (Nras)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    138816569 (Nras)
  09162 Cancer: specific types
   05210 Colorectal cancer
    138816569 (Nras)
   05225 Hepatocellular carcinoma
    138816569 (Nras)
   05226 Gastric cancer
    138816569 (Nras)
   05214 Glioma
    138816569 (Nras)
   05216 Thyroid cancer
    138816569 (Nras)
   05221 Acute myeloid leukemia
    138816569 (Nras)
   05220 Chronic myeloid leukemia
    138816569 (Nras)
   05218 Melanoma
    138816569 (Nras)
   05211 Renal cell carcinoma
    138816569 (Nras)
   05219 Bladder cancer
    138816569 (Nras)
   05215 Prostate cancer
    138816569 (Nras)
   05213 Endometrial cancer
    138816569 (Nras)
   05224 Breast cancer
    138816569 (Nras)
   05223 Non-small cell lung cancer
    138816569 (Nras)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    138816569 (Nras)
   05170 Human immunodeficiency virus 1 infection
    138816569 (Nras)
   05161 Hepatitis B
    138816569 (Nras)
   05160 Hepatitis C
    138816569 (Nras)
   05163 Human cytomegalovirus infection
    138816569 (Nras)
   05167 Kaposi sarcoma-associated herpesvirus infection
    138816569 (Nras)
   05165 Human papillomavirus infection
    138816569 (Nras)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    138816569 (Nras)
   05022 Pathways of neurodegeneration - multiple diseases
    138816569 (Nras)
  09165 Substance dependence
   05034 Alcoholism
    138816569 (Nras)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    138816569 (Nras)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    138816569 (Nras)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    138816569 (Nras)
   01522 Endocrine resistance
    138816569 (Nras)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dmer04131]
    138816569 (Nras)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dmer04147]
    138816569 (Nras)
   04031 GTP-binding proteins [BR:dmer04031]
    138816569 (Nras)
Membrane trafficking [BR:dmer04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    138816569 (Nras)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    138816569 (Nras)
Exosome [BR:dmer04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   138816569 (Nras)
  Exosomal proteins of other body fluids (saliva and urine)
   138816569 (Nras)
  Exosomal proteins of breast cancer cells
   138816569 (Nras)
  Exosomal proteins of colorectal cancer cells
   138816569 (Nras)
GTP-binding proteins [BR:dmer04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    138816569 (Nras)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Hpr_kinase_C Ldh_1_N
Other DBs
NCBI-GeneID: 138816569
NCBI-ProteinID: XP_069862507
LinkDB
Position
Unknown
AA seq 210 aa
MAVPGSPALLPGEVLGAGLCEMTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDS
YRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQ
IKRVKDSEDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTL
VREIRQYRMKKLNSSDDGTRGCMGLPCVLM
NT seq 633 nt   +upstreamnt  +downstreamnt
atggcggttccggggtctccggctcttctcccgggtgaagtcctaggtgctggcctgtgt
gaaatgaccgagtacaaactggtggtggtcggagcaggtggcgttgggaagagcgcgctg
accatccagctgatacagaaccacttcgtggatgagtatgaccctaccatagaggattct
taccgaaagcaggtagtgatagacggagaaacctgtctgctcgacatcctggacaccgct
ggacaggaggagtacagcgctatgagggatcagtatatgaggacaggcgagggcttcctc
tgcgtgtttgctattaataacagcaagtcatttgcagacatcaacctgtacagggagcag
attaagcgagtgaaggactccgaggatgtgcccatggtgctggtggggaacaaatgtgac
ttgcccacaaggacagtggacacaaaacaagcccacgaactggccaagagctacgggatc
ccattcatcgaaacctcagccaagaccagacagggtgtcgaggatgccttttacaccctg
gtgagagagatccgccagtaccgaatgaaaaagctcaacagcagtgacgacgggacccgg
ggctgcatgggcttgccttgtgtgctgatgtag

DBGET integrated database retrieval system