KEGG   Dipodomys merriami (Merriam's kangaroo rat): 138839609
Entry
138839609         CDS       T11079                                 
Symbol
Timm17b
Name
(RefSeq) mitochondrial import inner membrane translocase subunit Tim17-B
  KO
K17795  mitochondrial import inner membrane translocase subunit TIM17
Organism
dmer  Dipodomys merriami (Merriam's kangaroo rat)
Brite
KEGG Orthology (KO) [BR:dmer00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dmer03029]
    138839609 (Timm17b)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dmer02000]
    138839609 (Timm17b)
Mitochondrial biogenesis [BR:dmer03029]
 Mitochondrial protein import machinery
  Inner mambrane
   TIM23 complex
    138839609 (Timm17b)
Transporters [BR:dmer02000]
 Other transporters
  Primary active transporters [TC:3]
   138839609 (Timm17b)
SSDB
Motif
Pfam: Tim17
Other DBs
NCBI-GeneID: 138839609
NCBI-ProteinID: XP_069895278
LinkDB
Position
Unknown
AA seq 173 aa
MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAVKGFRNAPVGIQQRFRGSVNAVRIRAP
QIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARSGPLAMVGSAMMGG
ILLALIEGVGILLTRYTAQQFRNAPPFFEDPSQLGPKDGSSPAPGYPGYQQFH
NT seq 522 nt   +upstreamnt  +downstreamnt
atggaggagtacgctcgggagccttgcccatggaggattgtggatgactgcggaggagcc
ttcactatgggtgtcattggtggtggagtcttccaggcagtcaagggctttcgtaatgcc
cctgttggaattcaacaacggttcagagggagtgtcaatgctgtgaggattcgagccccc
cagattggaggtagttttgcagtgtggggaggcctattctccaccattgattgtggcttg
gtacgacttcggggcaaagaggatccctggaactccatcaccagtggtgccttgactggg
gctgtgctggctgctcgcagtggcccattggccatggtgggctcagccatgatggggggc
atcctattggctctcattgagggtgtgggcatcctcctcacacgctataccgcacagcag
ttccgcaatgcacctccattcttcgaagaccccagtcaactaggtccaaaggatggtagt
agcccagctcctggctatcctggctaccaacaattccactga

DBGET integrated database retrieval system