KEGG   Daphnia magna (water flea): 116918853
Entry
116918853         CDS       T07514                                 
Name
(RefSeq) cytochrome P450 306a1 isoform X1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
dmk  Daphnia magna (water flea)
Pathway
dmk00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:dmk00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    116918853
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:dmk00199]
    116918853
Enzymes [BR:dmk01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     116918853
Cytochrome P450 [BR:dmk00199]
 Cytochrome P450, animal type
  CYP306 family
   116918853
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 116918853
NCBI-ProteinID: XP_032780532
LinkDB
Position
LG1:complement(1148228..1152997)
AA seq 585 aa
MVVARSPYPNVEDIRDVSFLFSPCKLKREKNRHVDRSSGKNKKKEGRKEACSDDMWVWLC
LSSLLLGLVALLWLRDAAKQQHLPPGPVGLPFLGYLPWIDSVAPYETFARLSHRYGRIYS
LRLGNMLAIFVTDPQLVRQAFSRPVFSGRAPLYLTHGIMKGHGLICAEGDSWREHRRFVI
NVMKQLGMAGRQGASLMESRVMDRVLEFVDGLKSKVSSTSGVDLVPGLRHCIGNIINGVV
FGRTYAADDPTWIWLQHLLDEGVKQVAVAGPINFLAVLRFLPRYRNIMSFIIDGQVATHR
HYQEIIDDHERQLNQLADNQESSHGYTDVIEAYLIEMSRRRRANEAAGTFTITQLYHVLA
DMFGAGTDTALTTIKWIILYVILYPDVQTQIHEEIDRVVGEDGKRAGTLCYATDAQRMPW
TEAVICEVQRIKTILPLGVPHGTLDDCELAGYRIPKGAMVVPVWWAMNLDPTLWSDPLQF
RPERFLVRASHGEWTLIKPDHFLPFQSGRRMCIGDELGKTIIFLFTVTLLQRFRLTFPPQ
FEDYQPVVAPDGKRTDEMPRPDYGFTLVPHPYPVALHPRSPPTTG
NT seq 1758 nt   +upstreamnt  +downstreamnt
atggtggttgcaaggtcgccctacccaaacgtagaggacattcgtgacgtttcattctta
ttctctccttgcaaactgaaacgggaaaagaacagacacgtcgatcgttcaagtggcaag
aacaagaagaaagaaggaaggaaggaagcctgttctgacgacatgtgggtctggctgtgc
ctgtcgagtcttctgcttggattggtggcgttgctatggttacgcgacgccgccaaacaa
caacacttgccaccaggaccggtgggcttgccttttctcggctatttgccgtggatcgac
agcgtggcaccttacgaaacatttgcccgtttgagccaccgttacggccgcatttattct
ctccgattgggcaacatgttggccattttcgtcaccgatccgcagctagtccgccaggct
ttcagtagacccgttttcagcggacgagcaccgctctacttaacccacggcatcatgaaa
ggccacggtttgatttgcgctgaaggcgactcgtggcgagagcatcgacgtttcgttatc
aacgttatgaaacaactgggcatggccggacgtcaaggcgcctcactgatggagtcacgt
gtcatggaccgtgtcctggaatttgtggacggattgaagagcaaagtgtcatcgaccagc
ggcgtcgacttggtgcccggcttgcgtcactgcataggcaacatcatcaacggcgtcgtt
ttcggccggacgtacgcggccgacgatccgacctggatttggctgcagcacctgctcgat
gagggcgtcaaacaggtggccgtcgccgggcccatcaatttcctggccgtcctcaggttc
ttgcccagatatcgcaacatcatgtcgttcatcattgacggccaagtggcaactcatcgc
cattaccaagagattatcgacgatcacgagcgccagctcaatcagctcgccgacaatcaa
gaatcgagtcatggatatacggacgtgatcgaggcttacctcattgaaatgtctcgtcga
cgtcgtgccaatgaagcggctggaacgttcaccatcactcaactgtatcacgtgctggcc
gacatgttcggtgctggaacagacacggcattgacgacaatcaaatggatcatcctctac
gtcattctctacccggacgtgcaaactcaaattcacgaggaaatcgatcgcgtcgttggc
gaggatggcaaacgagccgggactctttgctatgccaccgatgcccagcggatgccctgg
acggaggccgtcatttgcgaagtgcagcgcatcaagaccatcttgcctctgggagtgcct
catggaacactggacgattgtgaattggccggctatcgtattcctaaaggggccatggtc
gtgcccgtctggtgggccatgaatctcgatccgaccttgtggagcgatccgttgcaattc
cggccggagcgtttcctagtgcgcgcatcgcacggtgaatggacgctgatcaaaccggac
cattttctaccgttccagtccggaaggcggatgtgtattggcgatgagttgggcaagacg
atcatcttcctgttcaccgtgacgctgctccagcgcttccggctgacgttccctccccaa
tttgaagattatcagcccgttgtcgcaccggatggcaaacggacggatgaaatgcctcgt
cccgactacgggttcacgctcgtacctcacccatatccagtggctctccatccgcgctct
ccaccaacaactggatga

DBGET integrated database retrieval system