Desulfococcus multivorans: Dmul_13460 Help Entry Dmul_13460        CDS       T04568                                  Symbol acp Name (GenBank) Acp: acyl carrier protein   KO K02078   acyl carrier protein Organism dml  Desulfococcus multivorans Pathway dml01100   Metabolic pathways dml01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dml00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Dmul_13460 (acp)    00074 Mycolic acid biosynthesis     Dmul_13460 (acp)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Dmul_13460 (acp) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AOY58121 LinkDB All DBs Position complement(1513854..1514108) Genome browser AA seq 84 aa AA seqDB search MMEIDDKVYERIMEILKPLVPEGVTAGMETDLTVDLGFDSLKVMKLLEDLEDGFDISIPI SILPEVRTVQDLMHQIQKLSQPGT NT seq 255 nt NT seq  +upstreamnt  +downstreamnt ttgatggaaatagacgataaggtatatgaacggatcatggaaattctgaagccgctggtc cccgaaggcgtgacggccggaatggagaccgacctgacggtagacctgggtttcgattca ttgaaagtgatgaagcttctcgaggatctggaggacggcttcgatatctcaatccccatc agcatattgccggaagtccgcacggtgcaggatctgatgcaccagattcagaaactctct caacccggaacatga

DBGET integrated database retrieval system