Desulfococcus multivorans: Dmul_19350 Help Entry Dmul_19350        CDS       T04568                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dml  Desulfococcus multivorans Pathway dml01100   Metabolic pathways dml01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dml00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Dmul_19350    00074 Mycolic acid biosynthesis     Dmul_19350   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Dmul_19350 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AOY58708 LinkDB All DBs Position complement(2163681..2163938) Genome browser AA seq 85 aa AA seqDB search MTSDELKNIILEIIRDIAPEADLSELDPDTRFRDQFEFSSVDFLNFSIKLQERLGIRIPE TECPLLASLSGCLSYLGPKYRQKEV NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgacatcagacgaactcaaaaacatcatcctggagatcatccgggacattgcgccggaa gcggacctttccgaactcgatccggatacccggttccgggaccagttcgagttcagttcg gtggactttctgaacttctcgatcaagcttcaggaacggctcgggatccgaatccccgag acggaatgtcccctcctggcctccctttccggatgcctctcctatcttgggcccaaatac cgtcaaaaggaggtatga

DBGET integrated database retrieval system