Desulfococcus multivorans: Dmul_28070 Help Entry Dmul_28070        CDS       T04568                                  Symbol acpP Name (GenBank) AcpP: acyl carrier protein   KO K02078   acyl carrier protein Organism dml  Desulfococcus multivorans Pathway dml01100   Metabolic pathways dml01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dml00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Dmul_28070 (acpP)    00074 Mycolic acid biosynthesis     Dmul_28070 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Dmul_28070 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Motif Other DBs NCBI-ProteinID:  AOY59579 LinkDB All DBs Position 3167698..3167940 Genome browser AA seq 80 aa AA seqDB search MTDIDKIQEKVKKIIAEKLSVDIDEVIPEAAFVDDLGADSLDLVELIMSMEEEFDIEISD EDSEKMVKVQDAFDYIAKNS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgaccgatatcgataagattcaagaaaaagtaaaaaagattattgcggaaaaactgagc gtagacatcgacgaagtgattcccgaggctgcctttgtggacgatctcggtgccgactct ctggacctggtggagttgatcatgtccatggaggaagagttcgacattgaaatctcggac gaagattccgaaaaaatggtgaaggttcaggacgcattcgactacatcgccaagaattcc tga

DBGET integrated database retrieval system