Desulfonema magnum: dnm_055060 Help Entry dnm_055060        CDS       T07102                                  Symbol hup Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism dmm  Desulfonema magnum Brite KEGG Orthology (KO) [BR:dmm00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:dmm03032]     dnm_055060 (hup)    03036 Chromosome and associated proteins [BR:dmm03036]     dnm_055060 (hup)    03400 DNA repair and recombination proteins [BR:dmm03400]     dnm_055060 (hup) DNA replication proteins [BR:dmm03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     dnm_055060 (hup) Chromosome and associated proteins [BR:dmm03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     dnm_055060 (hup) DNA repair and recombination proteins [BR:dmm03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       dnm_055060 (hup) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  QTA89452 UniProt:  A0A975BPR6 LinkDB All DBs Position 4380200..4380472 Genome browser AA seq 90 aa AA seqDB search MTKAELVDNMAQDAGITKVQAAAALKSFTDNVIETLKKKEGKVTLVGFGTFSKTRRKARK GRNPQTGDPIKIKACNVVKFRPGKHLRDAV NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgacaaaagcagaattggtagataacatggctcaggatgctggcattaccaaagttcag gcggctgccgcactcaaatcctttacggataacgtaatcgaaacattgaagaaaaaggaa ggcaaggttacattggtgggatttggcacattctcaaaaacccgccgcaaagcgcggaaa ggacgtaaccctcagacaggagatcctattaaaattaaagcatgtaatgtggtaaaattc agacctggcaagcacctcagagatgctgtctaa

DBGET integrated database retrieval system