Drosophila miranda: 108153015 Help Entry 108153015         CDS       T06132                                  Name (RefSeq) ras-related protein Rac2   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism dmn  Drosophila miranda Pathway dmn04013   MAPK signaling pathway - fly dmn04145   Phagosome dmn04148   Efferocytosis dmn04310   Wnt signaling pathway dmn04620   Toll-like receptor signaling pathway dmn05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:dmn00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     108153015    04310 Wnt signaling pathway     108153015  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     108153015    04148 Efferocytosis     108153015  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     108153015  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     108153015  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dmn04131]     108153015   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dmn04147]     108153015    04031 GTP-binding proteins [BR:dmn04031]     108153015 Membrane trafficking [BR:dmn04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     108153015  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     108153015   Macropinocytosis    Ras GTPases     108153015  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     108153015 Exosome [BR:dmn04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108153015   Exosomal proteins of other body fluids (saliva and urine)    108153015   Exosomal proteins of colorectal cancer cells    108153015   Exosomal proteins of bladder cancer cells    108153015 GTP-binding proteins [BR:dmn04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     108153015 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU CagD Motif Other DBs NCBI-GeneID:  108153015 NCBI-ProteinID:  XP_017138250 LinkDB All DBs Position XR:24011460..24013619 Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSVPIILVGTKLDLR DDKATIEKLKDKKLTPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVLCPV VRRPPRRLCKLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggccatcaagtgcgttgttgttggcgacggagccgtgggcaagacctgcctcctg atcagctacacgaccaatgccttccccggagaatacattccgacggtgttcgataattac tcggccaacgtgatggtggatgccaagcccatcaatctaggactgtgggatacggccggg caggaggactacgatcggttgcgtccgctctcctacccgcagacggacgtcttcctcatc tgcttctcgctggtcaatcccgcctccttcgagaacgtgcgggccaagtggtaccccgag gtgcgtcaccactgccccagtgtgccgatcattctggtgggcaccaagctggatctgcgc gatgacaaggccaccatcgagaagctcaaggacaagaagctgacgcccatcacctatccg cagggtctggccatggccaaggagatcggagccgtcaagtatctggagtgctcggctctg acccagaagggcctgaagacggtcttcgacgaggccatccgctctgtgctttgtccggtg gtgcgcaggcccccccgtcgcttgtgcaagctgctgtag

DBGET integrated database retrieval system