Drosophila miranda: 108153146 Help Entry 108153146         CDS       T06132                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism dmn  Drosophila miranda Pathway dmn04013   MAPK signaling pathway - fly dmn04145   Phagosome dmn04148   Efferocytosis dmn04310   Wnt signaling pathway dmn04517   IgSF CAM signaling dmn04518   Integrin signaling dmn04620   Toll-like receptor signaling pathway dmn05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:dmn00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     108153146    04310 Wnt signaling pathway     108153146   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     108153146    04518 Integrin signaling     108153146  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     108153146    04148 Efferocytosis     108153146  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     108153146  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     108153146  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dmn04131]     108153146   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dmn04147]     108153146    04031 GTP-binding proteins [BR:dmn04031]     108153146 Membrane trafficking [BR:dmn04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     108153146  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     108153146   Macropinocytosis    Ras GTPases     108153146  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     108153146 Exosome [BR:dmn04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108153146   Exosomal proteins of other body fluids (saliva and urine)    108153146   Exosomal proteins of colorectal cancer cells    108153146   Exosomal proteins of bladder cancer cells    108153146 GTP-binding proteins [BR:dmn04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     108153146 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  108153146 NCBI-ProteinID:  XP_017138436 LinkDB All DBs Position XR:complement(10935310..10937355) Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLR DDKNTIEKLRDKKLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVLCPV LQPKSKRKCALL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggcgattaagtgtgtcgttgtgggcgacggagccgtgggtaagacctgcttgctg atcagctacacgacaaatgcgtttcccggcgagtacatacccaccgtgttcgacaactac tcggccaatgtgatggtcgatgccaagcccattaatttgggattgtgggatacggccggg caggaggactacgaccgcctgcgtccgctgtcctatccacagacagatgtcttcctcatt tgcttctcgctggtgaatccggcctcgttcgagaacgtgcgcgcaaagtggtatccggag gtgcggcaccactgccccagcacacccatcatcctggtgggcaccaagctggatttgcgc gacgacaagaacaccatcgagaagctgcgcgacaagaagctggcacccatcacctatccc cagggcctggccatggctaaggagattggcgccgtcaaatatctggagtgctcggcgcta acgcaaaagggactgaagacggtgttcgatgaggctatcagatcggtgctctgcccagtg ctgcagcccaagtccaagcgcaagtgcgccctgctctaa

DBGET integrated database retrieval system