Drosophila miranda: 108155786 Help Entry 108155786         CDS       T06132                                  Name (RefSeq) BBSome-interacting protein 1   KO K19399   BBSome-interacting protein 1 Organism dmn  Drosophila miranda Brite KEGG Orthology (KO) [BR:dmn00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:dmn03037]     108155786 Cilium and associated proteins [BR:dmn03037]  Primary cilia and associated proteins   BBSome    108155786 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  BBIP10 Motif Other DBs NCBI-GeneID:  108155786 NCBI-ProteinID:  XP_017142335 LinkDB All DBs Position 2:complement(3342625..3343032) Genome browser AA seq 78 aa AA seqDB search MSAVESELLRKVNEKIDLIEPTTGKLFFEHKTELAFCRPHLMPLKTQALERLEEMHRETA RQLQKKRNNKKITEPHKE NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtccgcagtggagtctgagctgcttagaaaagtgaatgagaaaatcgatctgattgag cccacaaccggaaaactgtttttcgagcacaaaacagagctggctttctgtaggccgcac ctgatgccgctaaagacgcaggcgctggaacggctagaggaaatgcatcgcgaaactgcg cgtcagctgcaaaagaagcgaaacaataagaaaatcaccgagccccacaaggaatag

DBGET integrated database retrieval system