Drosophila miranda: 108156547 Help Entry 108156547         CDS       T06132                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism dmn  Drosophila miranda Pathway dmn04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:dmn00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     108156547  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:dmn04121]     108156547    03400 DNA repair and recombination proteins [BR:dmn03400]     108156547 Ubiquitin system [BR:dmn04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      108156547    Cul5 complex      108156547 DNA repair and recombination proteins [BR:dmn03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      108156547 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin GABP-alpha Rad60-SLD Motif Other DBs NCBI-GeneID:  108156547 NCBI-ProteinID:  XP_017143554 LinkDB All DBs Position 2 Genome browser AA seq 118 aa AA seqDB search MDVFLMIRRQKTTIFTDAKENTTVAELKRMIEGILKVQVVDQRLYNQDNDIMEDDSTLQE YGVTVSTAKAQSPAQLGLTFRNDMGDFETLDMTPYSAPPDLPEVMKNQEASNGQEAVA NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggacgtgttcctcatgatcagacggcaaaagacgacgattttcacggatgccaaagag aacactaccgttgccgagctgaaacgtatgattgaaggcattctaaaagtacaagtcgtc gatcagcggttgtacaaccaggacaacgacattatggaggatgacagcacgttgcaggag tacggcgtgacggtatccacggcgaaggcacagtcgccggcgcaactgggcttgacattc agaaacgacatgggcgactttgaaacactggatatgacgccatactcagcaccacccgac ttaccagaagtgatgaaaaaccaagaagcctcaaacggacaggaggcagtcgcataa

DBGET integrated database retrieval system