Drosophila miranda: 108156972 Help Entry 108156972         CDS       T06132                                  Name (RefSeq) dynein light chain Tctex-type   KO K10420   dynein light chain Tctex-type 1/3 Organism dmn  Drosophila miranda Pathway dmn04145   Phagocytosis dmn04814   Motor proteins Brite KEGG Orthology (KO) [BR:dmn00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     108156972   09142 Cell motility    04814 Motor proteins     108156972  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:dmn03037]     108156972    04812 Cytoskeleton proteins [BR:dmn04812]     108156972 Cilium and associated proteins [BR:dmn03037]  Motile cilia and associated proteins   Dynein arm    108156972 Cytoskeleton proteins [BR:dmn04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      108156972 SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 MCEL_GT_NTPase DUF6547 Fascin Motif Other DBs NCBI-GeneID:  108156972 NCBI-ProteinID:  XP_017144251 LinkDB All DBs Position 2 Genome browser AA seq 111 aa AA seqDB search MDDSREESQFIVDDVSKTIKEAIETTIGGNAYQHDKVNNWTGQVVENCLTVLTKEQKPYK YIVTAMIMQKNGAGLHTASSCYWNNDTDGSCTVRWENKTMYCIVSVFGLAV NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggatgactcacgcgaagaaagccagttcatagtggatgatgtgagcaagacgattaag gaggccatcgagaccaccatcggaggtaacgcgtaccagcacgacaaggtgaacaactgg accggccaggtggtggagaactgcctgacggtgctcaccaaggagcagaagccctataag tacatcgtcacggccatgatcatgcagaagaatggagccggactgcacacggccagctcc tgctactggaacaacgacacagacggcagctgcacagtccgctgggagaacaagaccatg tactgcatcgtgtccgtcttcggcctggccgtttag

DBGET integrated database retrieval system