Drosophila miranda: 108160108 Help Entry 108160108         CDS       T06132                                  Name (RefSeq) diptericin A-like   KO K20669   diptericin Organism dmn  Drosophila miranda Pathway dmn04624   Toll and Imd signaling pathway Brite KEGG Orthology (KO) [BR:dmn00001]  09150 Organismal Systems   09151 Immune system    04624 Toll and Imd signaling pathway     108160108  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:dmn02000]     108160108 Transporters [BR:dmn02000]  Other transporters   Pores ion channels [TC:1]    108160108 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Attacin_C Motif Other DBs NCBI-GeneID:  108160108 NCBI-ProteinID:  XP_017149389 LinkDB All DBs Position 3:complement(9592224..9595537) Genome browser AA seq 102 aa AA seqDB search MQSTIVLALLCCIVGAVVAYPADDMTMPSTPPPRYPLNLQGGGGAQEREGFNFGVRGSEN VWRSDNGRHEIDVNGGYAQRLGGKWGNSEPSYSVGTNYRYRW NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgcagtctacaatcgtcctcgctctgctctgctgcattgtcggtgctgtggtggcatat ccggccgatgacatgacgatgccctcgacgccacctcctcgctatcccctcaacttgcag ggcggcggcggggcccaggagcgcgagggattcaactttggagtgcgtggcagcgagaac gtgtggaggagcgacaacgggcggcacgagatcgacgtgaacggcggatatgcccagcgt ttgggcggaaagtggggcaactcggagccgagctacagcgttggcaccaactaccgctac agatggtag

DBGET integrated database retrieval system