Drosophila miranda: 108160431 Help Entry 108160431         CDS       T06132                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism dmn  Drosophila miranda Brite KEGG Orthology (KO) [BR:dmn00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:dmn03041]     108160431   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dmn04052]     108160431 Spliceosome [BR:dmn03041]  Complex B   Other components    Complex B specific factors     108160431 Cytokines and neuropeptides [BR:dmn04052]  Neuropeptides   Unclassified    108160431 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 PI3K_rbd Crinkler OTU1_UBXL Rad60-SLD Motif Other DBs NCBI-GeneID:  108160431 NCBI-ProteinID:  XP_017149923 LinkDB All DBs Position 3:complement(4695091..4695628) Genome browser AA seq 73 aa AA seqDB search MIEITCNDRLGKKVRVKCNPDDTVGDLKKLIAAQTGTKHEKIVLKKWYTIYKDPIRLSDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatagaaataacttgcaacgatcgactgggcaagaaggtgcgcgtcaaatgcaatccg gacgacactgttggagacttgaagaaacttattgcggcacagacgggcacaaagcacgag aagattgtcctgaagaagtggtacacaatctacaaggatcccatccgcctatctgattat gaaatccatgacggcatgaacttggaactttactaccaataa

DBGET integrated database retrieval system