KEGG   Drosophila miranda: 108164672
Entry
108164672         CDS       T06132                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
dmn  Drosophila miranda
Pathway
dmn00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:dmn00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    108164672
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:dmn00199]
    108164672
Enzymes [BR:dmn01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     108164672
Cytochrome P450 [BR:dmn00199]
 Cytochrome P450, animal type
  CYP306 family
   108164672
SSDB
Motif
Pfam: p450 Ndc1_Nup Neur_chan_memb
Other DBs
NCBI-GeneID: 108164672
NCBI-ProteinID: XP_017156013
LinkDB
Position
XL:complement(24731864..24734424)
AA seq 641 aa
MSASFATASASASVFDWLPLSGHSFCLLVVPGLLILIILWLCDHQYDRVLGRPPPGPWGL
PWLGYLPFLSRRAPHKSLQALARRYGGIYQLRMGSVKAVILSDVTLVREFFRHEVMAARA
PLYLTHGIMGGYGIICAAGPIWKHQRRELIDWLKALGMTRRPGETRSRLEQRIGRGVDEC
VQLYETDADVSPSSEFDPVPALQHTLGNIINDLVFGVTYERQDADWLYLQRLQEEGVKLI
GVSGVVNFLPWLRRLPWNRRNICFLMEGKSRTHAIYDRIVESCENKLKELQEQYQEKQRQ
RQQQQDIQQYPQQDLQQDPEPESESEQSLQQSTEQKGERQVAAAAQEVPHEQVPAKKEDQ
DPNQHAEQKQVGDRVTEHEQKQGPEQEEDQKEEEEEDDDDDVYEPTCILEHFLINRVPFS
ELYCDEQLRHLLADLFGAGVDTSLATLRWFLLYMAREQSSQRRLHELLLPLSATPTLEEL
QPLAFLRACISEVQRIRSVVPLGIPHGAERDFTVGKYRIAAGSMIVSLQWAIHMDPAVWP
EPEQFRPDRFLNAEGHYSAPPQFVPFQTGKRMCPGDELARMMLTLFAGRILRRFHVEMVP
GCDADMEGECGITLAPAPYKLRFTKLPPMELQVEEQPLVQA
NT seq 1926 nt   +upstreamnt  +downstreamnt
atgtcggcctccttcgccaccgcctccgcctccgcctccgtcttcgactggttgcccctg
tcaggacacagtttttgcctgctggtggtgcccgggctgcttatcctgatcatcctctgg
ctgtgcgaccaccagtacgacagagtactgggacgtccgcccccagggccatggggtctg
ccgtggctgggctacctgcccttcctaagccgccgggcaccccacaaatcgctgcaggct
ttggcccgccgctacgggggcatctatcaactgcgcatgggcagcgtgaaggcagtgata
ctctcggacgtgaccctggtccgggagttcttccgccacgaggtgatggcggctcgggcg
ccgctctacctcacacacggcatcatgggcggatatggcatcatctgcgccgcgggtccc
atttggaaacatcagcgtcgagagcttatcgattggctgaaggcattggggatgacgcgg
cgaccgggagagacgcgaagccgtctcgagcagcggatcgggaggggtgtggacgagtgt
gtgcagctgtacgaaacggatgcggatgtgagtccttcgtcggagttcgacccggtgccc
gccctccagcacacgcttgggaatatcatcaacgatctggtcttcggtgtcacctacgag
cggcaggacgccgattggctgtacctgcaacgactgcaggaggagggggtcaagctgatc
ggcgtctcgggcgtggtcaacttcctgccctggctgcgacgcctgccgtggaatcggcgc
aacatatgcttcttgatggaaggcaagtccaggacgcacgccatctacgaccgcatcgtc
gagagttgcgagaataagcttaaggagctgcaagagcaatatcaggagaagcagcgccag
cgccaacagcagcaggatatacagcagtatccacagcaggacctacagcaggatccagag
cctgaatctgaatcggagcagagtctgcagcagagcacagaacaaaaaggggagaggcaa
gtagcagcagcagcacaagaagtgccccatgaacaagtcccagcaaagaaggaagatcaa
gatccgaatcagcacgcagaacagaagcaagtaggggaccgggtcaccgagcatgaacag
aagcaaggcccagagcaagaagaggatcagaaggaggaggaggaggaggacgacgacgac
gacgtgtatgaacctacttgtatcctggagcattttcttatcaaccgagtgcccttttcg
gagctatactgcgacgagcagctgcgccatctcctcgccgacctcttcggcgccggtgtg
gacacctccctcgccacgctccgctggttcctgctctacatggcccgcgagcagagctcc
cagcgccgtctgcacgagctgctccttcccctaagtgccacgcccacactggaggagctg
cagccgctggccttcctccgggcctgtatctcggaggtgcagcgtatacgcagcgtggtg
ccgctaggcattccgcacggagccgagcgggacttcactgtgggaaagtaccggatcgcg
gccggcagcatgatcgtctcacttcagtgggccattcacatggacccggcggtgtggccg
gagccggagcagttccgtccggatcgctttctcaatgccgaaggacactactcggcgccg
ccccagtttgtccccttccagacgggcaagcgcatgtgtcctggcgatgagctggctcgc
atgatgctaacccttttcgctggtcgcatcctgagacgctttcacgtggagatggtcccc
ggctgcgatgcggacatggaaggcgagtgcggcatcaccttggcacccgctccctacaag
ctgcgcttcacgaagcttccgcccatggaattgcaagtggaggagcagccactggtgcag
gcctag

DBGET integrated database retrieval system