Drosophila miranda: 117193550 Help Entry 117193550         CDS       T06132                                  Name (RefSeq) immune-induced peptide 3-like   KO K20695   immune-induced peptide 1/2/3 Organism dmn  Drosophila miranda Pathway dmn04624   Toll and Imd signaling pathway Brite KEGG Orthology (KO) [BR:dmn00001]  09150 Organismal Systems   09151 Immune system    04624 Toll and Imd signaling pathway     117193550 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DIM Motif Other DBs NCBI-GeneID:  117193550 NCBI-ProteinID:  XP_033254188 LinkDB All DBs Position Y Genome browser AA seq 40 aa AA seqDB search MKFLSLAFVLGLMAALVNATPLNPGNVIINGDCRTCNVRA NT seq 123 nt NT seq  +upstreamnt  +downstreamnt atgaaattcctctcgcttgcctttgtcctgggcctgatggcggctctggttaacgccacg ccactgaaccccggaaatgtcatcatcaacggcgactgccgcacgtgcaatgtgagggct taa

DBGET integrated database retrieval system