KEGG   Drosophila mojavensis: Dmoj_GI11185
Entry
Dmoj_GI11185      CDS       T01062                                 
Name
(GenBank) uncharacterized protein, isoform C
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
dmo  Drosophila mojavensis
Pathway
dmo00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:dmo00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    Dmoj_GI11185
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:dmo00199]
    Dmoj_GI11185
Enzymes [BR:dmo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     Dmoj_GI11185
Cytochrome P450 [BR:dmo00199]
 Cytochrome P450, animal type
  CYP306 family
   Dmoj_GI11185
SSDB
Motif
Pfam: p450 SUIM_assoc
Other DBs
NCBI-ProteinID: KRG07499
FlyBase: FBgn0133946
UniProt: A0A0Q9XG70
LinkDB
AA seq 352 aa
MSLQAYESEAKAPLDPLPALQHTLGNIINDLVFGETYERHDPNWLYLQQLQEQGVKLIGV
SGMVNFLPWLRHLPGNKRSIRFLLDGKAKTHALYDRIIARCAQQLQQEKEQQQQQQQQQS
PGRSILAHFLHERQPYSQLYCDEQLRHLLADLFGAGVDTSLATLRWFLLYMAREQRCQQR
LQSELRHLSESPTLAELEPIAYLRACLSEAQRIRSVVPLGIPHGVDQDTMVGDYHLRKGT
MVLVLQWAIHMNPEAWPEPEQFRPERFLSADGDYVAPAQFIPFQTGKRMCPGDELARMML
TLYAGRILRRFHVQLPAGEAQHVDFEGECGITLAPAHYKLQFTPMEELPKND
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgtcgttacaggcctacgagtcggaggcgaaggccccactggatccgctgccggcgctg
cagcacacgctgggcaacatcatcaatgatctggtctttggcgagacctacgagcgccac
gatcccaactggctgtacctgcagcagctgcaggagcagggcgtcaagctgatcggcgtc
tcgggcatggtcaactttttgccctggctgcgccatctgccgggcaacaagcgcagcata
cgcttcctgctggacggcaaggccaagacgcatgcgctctacgatcgcatcatcgcacgc
tgcgcgcagcagctacaacaggaaaaggaacagcagcagcagcagcagcagcagcagtcg
cctggccgcagcatcttggcgcacttcctgcacgaacgtcagccctactcacaactgtat
tgcgatgagcaactgcgtcacctgctggccgatctctttggcgccggcgtggacacgtcg
ctggcaacgctgcgctggttcctactctatatggcgcgcgagcagcgctgccagcagcga
ctgcagtcggagctgcgccacctcagcgagtcgcccacgctggccgagctcgagccgatc
gcctatctgcgcgcctgcctctcggaggcgcagcgcattcggtccgtcgtgccgctgggc
ataccgcacggcgtcgaccaggacaccatggtgggtgactaccacctgaggaagggcacc
atggtgctggtgctgcagtgggccatacacatgaatcccgaggcctggccggagccggag
cagttccggccggagcggtttctcagcgcggacggcgactatgtggcgcccgctcagttc
attcccttccagacgggcaagcgcatgtgtcccggcgatgagctggcccgcatgatgctc
acgctctacgcgggacgcattctgcgtcgcttccacgtgcagctgcccgccggagaggcg
cagcacgtggacttcgaaggcgaatgtggcatcaccttggctccggcgcactacaaactt
caatttacccctatggaagagctacccaagaatgactaa

DBGET integrated database retrieval system