Drosophila mojavensis: Dmoj_GI12280 Help Entry Dmoj_GI12280      CDS       T01062                                  Name (GenBank) uncharacterized protein   KO K04526   insulin Organism dmo  Drosophila mojavensis Pathway dmo04068   FoxO signaling pathway dmo04140   Autophagy - animal dmo04150   mTOR signaling pathway dmo04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:dmo00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     Dmoj_GI12280    04150 mTOR signaling pathway     Dmoj_GI12280  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     Dmoj_GI12280  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     Dmoj_GI12280  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dmo04052]     Dmoj_GI12280 Cytokines and neuropeptides [BR:dmo04052]  Neuropeptides   Neuropeptides (Unclassified)    Dmoj_GI12280 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-ProteinID:  EDW18094 FlyBase:  FBgn0135037 UniProt:  B4L0L7 LinkDB All DBs AA seq 112 aa AA seqDB search MSLRFNLALLLMLALLTQLVDGRRKLCGDALNEALDLICVNGFSHRIKRDSDRSRLLLVL RQQLDTGEQPQAPAERFNGAGVERVLRRSRRRITHKCCWDGCTYDDIREYCA NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atgagtttgcgcttcaatttggcgcttctgctgatgctggccctgctgacgcagttggtc gacggcaggaggaagctatgtggcgatgcactcaacgaggcccttgacctgatatgtgtt aatggattttcacacagaatcaagcgcgattcggaccgaagccgactgctgctggtactg aggcaacaactggacaccggcgagcagccccaggccccggcggagcggttcaatggggcc ggcgtggagcgggtgctgagacgttcgcggcgcagaataacgcacaaatgctgctgggat ggatgcacctacgacgacattcgggagtactgcgcctag

DBGET integrated database retrieval system