Drosophila mojavensis: Dmoj_GI16585 Help Entry Dmoj_GI16585      CDS       T01062                                  Name (GenBank) uncharacterized protein   KO K03008   DNA-directed RNA polymerase II subunit RPB11 Organism dmo  Drosophila mojavensis Pathway dmo03020   RNA polymerase dmo03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:dmo00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     Dmoj_GI16585   09124 Replication and repair    03420 Nucleotide excision repair     Dmoj_GI16585  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:dmo03021]     Dmoj_GI16585    03400 DNA repair and recombination proteins [BR:dmo03400]     Dmoj_GI16585 Transcription machinery [BR:dmo03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Core subunits      Dmoj_GI16585 DNA repair and recombination proteins [BR:dmo03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       Dmoj_GI16585 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_L_2 RNA_pol_L SHNi-TPR Motif Other DBs NCBI-ProteinID:  EDW11034 UniProt:  B4KFR9 LinkDB All DBs AA seq 117 aa AA seqDB search MNAPPTFESFLLYEGEKKIIKELDTKVTNAAIFTINKEDHTLGNMIRNQLLKDPNVLFAG YKVPHPLEHKFVIRIQTTADYSPQEAFMNAITDLLAELSLFEERFKDAIKEKKEGGD NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgaatgccccacccacatttgaatcgtttctgctctacgaaggcgagaaaaaaattatc aaggaactggacacgaaggtgacaaatgccgcaattttcaccataaacaaggaggatcac acgctgggcaacatgattcgcaaccaactattgaaggatccaaacgtgctctttgccggc tataaggtgccccatccgctggagcacaagttcgtcatccggatacagacgacggcggat tattcaccacaagaggcattcatgaatgccataacggacctgcttgcagaattgtcgctt ttcgaggagcgatttaaagatgccatcaaggagaagaaagaaggcggcgactag

DBGET integrated database retrieval system