Drosophila mojavensis: Dmoj_GI17191 Help Entry Dmoj_GI17191      CDS       T01062                                  Name (GenBank) uncharacterized protein   KO K10419   dynein light chain roadblock-type Organism dmo  Drosophila mojavensis Pathway dmo04814   Motor proteins Brite KEGG Orthology (KO) [BR:dmo00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     Dmoj_GI17191  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dmo04131]     Dmoj_GI17191   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:dmo03037]     Dmoj_GI17191    04812 Cytoskeleton proteins [BR:dmo04812]     Dmoj_GI17191 Membrane trafficking [BR:dmo04131]  Endosome - Golgi transport   Rab GTPases and associated proteins    Rab associated proteins     Dmoj_GI17191 Cilium and associated proteins [BR:dmo03037]  Motile cilia and associated proteins   Dynein arm    Dmoj_GI17191 Cytoskeleton proteins [BR:dmo04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      Dmoj_GI17191 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Robl_LC7 LAMTOR5 MAPKK1_Int Motif Other DBs NCBI-ProteinID:  EDW11531 UniProt:  B4KK13 LinkDB All DBs AA seq 97 aa AA seqDB search MSAEVEEMLKRFQNVKNIIGIVIADYDGIPIKTTLENVQSVHLACHMHLLTEKARQVILD LDATNEFVSMRMRTSYFEMILMPSDNYFIVVLQNPGD NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgtctgcagaagtggaggagatgctaaaacgttttcagaacgttaagaacatcattggc attgttattgccgactatgatggcattcccatcaagaccacattggagaacgtgcaatcg gttcacttggcttgtcacatgcatttgctaacggagaaggcgcgtcaggtgatattggat ctggatgctaccaatgaattcgtatctatgcgcatgcgcactagctattttgagatgata ctgatgccttccgataactatttcatagtcgtccttcagaatccgggcgattag

DBGET integrated database retrieval system