Drosophila mojavensis: Dmoj_GI18672 Help Entry Dmoj_GI18672      CDS       T01062                                  Name (GenBank) uncharacterized protein   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism dmo  Drosophila mojavensis Pathway dmo03060   Protein export dmo04141   Protein processing in endoplasmic reticulum dmo04145   Phagosome Brite KEGG Orthology (KO) [BR:dmo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     Dmoj_GI18672    04141 Protein processing in endoplasmic reticulum     Dmoj_GI18672  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     Dmoj_GI18672  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dmo04131]     Dmoj_GI18672   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:dmo02044]     Dmoj_GI18672 Membrane trafficking [BR:dmo04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     Dmoj_GI18672 Secretion system [BR:dmo02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    Dmoj_GI18672 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  SecE DUF4290 Motif Other DBs NCBI-ProteinID:  EDW10184 UniProt:  B4KPI8 LinkDB All DBs AA seq 111 aa AA seqDB search MDQRLQRRRRAPRKKRKTGLAKLLPDLSPNLRWTAKYTHLVWNQLMLLLLPLLPLLSFVK ESLLMIKRCTKPDRQEFQRSVLAITIGFLIMGFLGFIIKLLHIPITNIIMG NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggatcagcgtttacagcgtcgtcgtcgggcaccaagaaagaaacgaaagaccgggcta gccaagctactgccagatctgtcgcccaatttacgctggactgccaagtacacgcacctg gtgtggaatcagttgatgctcctgctgctgccgctgctgccgctgctgagcttcgtcaag gagtcgttgcttatgatcaagcgctgcacgaaaccggatcgccaggagttccagcgctcc gtgctggccatcacaatcggcttcctcataatgggcttcctcggcttcattatcaaactg ctgcacataccaatcactaatattattatgggctaa

DBGET integrated database retrieval system