Drosophila mojavensis: Dmoj_GI20882 Help Entry Dmoj_GI20882      CDS       T01062                                  Name (GenBank) uncharacterized protein   KO K03009   DNA-directed RNA polymerases I, II, and III subunit RPABC4 Organism dmo  Drosophila mojavensis Pathway dmo03020   RNA polymerase dmo03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:dmo00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     Dmoj_GI20882   09124 Replication and repair    03420 Nucleotide excision repair     Dmoj_GI20882  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:dmo03021]     Dmoj_GI20882    03400 DNA repair and recombination proteins [BR:dmo03400]     Dmoj_GI20882 Transcription machinery [BR:dmo03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      Dmoj_GI20882   RNA polymerase III system    RNA polymerase III      Dmoj_GI20882   RNA polymerase I system    RNA polymerase I      Dmoj_GI20882 DNA repair and recombination proteins [BR:dmo03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       Dmoj_GI20882 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DNA_RNApol_7kD A2L_zn_ribbon DUF5816 MCM_OB zinc_ribbon_13 DZR_2 DUF6083 Cytochrome_C7 HypA DZR YjdM_Zn_Ribbon Motif Other DBs NCBI-ProteinID:  EDW10089 FlyBase:  FBgn0143616 UniProt:  B4KP23 LinkDB All DBs AA seq 57 aa AA seqDB search MSETSSKENVKTAMTYICGECHHENEMRPRDPIRCRECGYRIMYKKRTKRLVVFDAR NT seq 174 nt NT seq  +upstreamnt  +downstreamnt atgtcagaaacaagctccaaggaaaatgtgaagaccgcaatgacttatatttgtggcgaa tgtcatcatgagaacgagatgcgtccacgtgatcccatacgttgccgcgagtgtggctac cgcatcatgtacaagaagcgcaccaagcgtcttgtcgtctttgatgcacgataa

DBGET integrated database retrieval system