Drosophila mojavensis: Dmoj_GI21688 Help Entry Dmoj_GI21688      CDS       T01062                                  Name (GenBank) uncharacterized protein   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism dmo  Drosophila mojavensis Pathway dmo00480   Glutathione metabolism dmo00980   Metabolism of xenobiotics by cytochrome P450 dmo00982   Drug metabolism - cytochrome P450 dmo00983   Drug metabolism - other enzymes dmo01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:dmo00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     Dmoj_GI21688   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     Dmoj_GI21688    00982 Drug metabolism - cytochrome P450     Dmoj_GI21688    00983 Drug metabolism - other enzymes     Dmoj_GI21688  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:dmo02000]     Dmoj_GI21688 Enzymes [BR:dmo01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      Dmoj_GI21688 Transporters [BR:dmo02000]  Other transporters   Pores ion channels [TC:1]    Dmoj_GI21688 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MAPEG Asp4 Motif Other DBs NCBI-ProteinID:  EDW06361 UniProt:  B4L5A2 LinkDB All DBs AA seq 165 aa AA seqDB search MSNTSAPAMHDKLTNMELLTLDNPVFCCYLFWATVLVVKMLLMSLLTALQRFRYKVFPNE EDLFFKNIEVQFDDPHVERVRRAHRNDMENILPYFIMALIYVCTNPNPLVACNLFRVAAI ARIVHTLVYALYPVPQPSRILAFATMLLITFYMAAVVALRTLRFI NT seq 498 nt NT seq  +upstreamnt  +downstreamnt atgtccaacacatctgctcctgcgatgcatgataagctgacaaatatggagctgctcaca ctggacaatcctgtcttctgttgctatctcttttgggccacagtcttggtggtaaagatg ctgctcatgtccctgttgacggcgttgcagcgcttccgctacaaggtctttcccaacgaa gaggatctgtttttcaagaacattgaagtgcagttcgatgatccacatgtggaacgcgtg cgaagagctcatcgcaatgatatggagaatattttgccatacttcatcatggccttgatc tatgtgtgcaccaaccccaatcctctcgtggcctgcaatctgttccgcgtggctgctatt gcacgcattgtccacacgctcgtctatgctctctacccagtgccgcagccatcacgaatt ttggcctttgccacgatgctgctgattaccttctacatggctgccgttgtggctttgcgt acattgcgtttcatttga

DBGET integrated database retrieval system