Drosophila mojavensis: Dmoj_GI22601 Help Entry Dmoj_GI22601      CDS       T01062                                  Name (GenBank) uncharacterized protein   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism dmo  Drosophila mojavensis Pathway dmo04013   MAPK signaling pathway - fly dmo04145   Phagosome dmo04148   Efferocytosis dmo04310   Wnt signaling pathway dmo04620   Toll-like receptor signaling pathway dmo05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:dmo00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     Dmoj_GI22601    04310 Wnt signaling pathway     Dmoj_GI22601  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     Dmoj_GI22601    04148 Efferocytosis     Dmoj_GI22601  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     Dmoj_GI22601  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     Dmoj_GI22601  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dmo04131]     Dmoj_GI22601   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dmo04147]     Dmoj_GI22601    04031 GTP-binding proteins [BR:dmo04031]     Dmoj_GI22601 Membrane trafficking [BR:dmo04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     Dmoj_GI22601  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     Dmoj_GI22601   Macropinocytosis    Ras GTPases     Dmoj_GI22601  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     Dmoj_GI22601 Exosome [BR:dmo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Dmoj_GI22601   Exosomal proteins of other body fluids (saliva and urine)    Dmoj_GI22601   Exosomal proteins of colorectal cancer cells    Dmoj_GI22601   Exosomal proteins of bladder cancer cells    Dmoj_GI22601 GTP-binding proteins [BR:dmo04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     Dmoj_GI22601 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 Motif Other DBs NCBI-ProteinID:  EDW15759 UniProt:  B4KB55 LinkDB All DBs AA seq 185 aa AA seqDB search MSKSLRPLKITIVGDGMVGKTCLLITYTQNEFPEEYIPTVFDNHACNITVDDNEYNLTLW DTAGQEDYERLRPLSYPNTNCFLLCYSISSRTSFENIKSKWWPEIRHFGTNVPVVLVGTK LDLRIPNSEKFVTTQEGRRLRKEIHAHSLVECSAKKKLNLEQVFEEAVRAVEKKPGKTPP TCKIL NT seq 558 nt NT seq  +upstreamnt  +downstreamnt atgtcgaaaagtctgcgccctcttaaaataaccatcgttggcgatggcatggtgggcaag acctgcctcctgataacctacacacagaacgaatttcccgaggagtatataccgactgta ttcgataaccatgcctgcaacataacggtcgatgataatgaatacaatctaacactctgg gacacggccgggcaggaggattacgaaagactgcgtccattgagctatcccaatacgaac tgcttcctattgtgctattccatcagcagtcgtacctctttcgagaacattaagagcaaa tggtggccggagattcgtcactttggcaccaacgtacccgttgttctggtgggtactaag ctcgacttgcgtataccgaattcggagaaatttgtgaccacgcaggaaggccggcggctg cgtaaggagattcatgcccatagtttggtcgagtgctcggccaagaagaagctgaactta gagcaggtgtttgaggaggcggtgcgtgcggtggaaaagaagccgggaaagactccacca acgtgcaaaatactttaa

DBGET integrated database retrieval system