Drosophila mojavensis: Dmoj_GI24021 Help Entry Dmoj_GI24021      CDS       T01062                                  Name (GenBank) uncharacterized protein   KO K03007   DNA-directed RNA polymerases I, II, and III subunit RPABC5 Organism dmo  Drosophila mojavensis Pathway dmo03020   RNA polymerase dmo03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:dmo00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     Dmoj_GI24021   09124 Replication and repair    03420 Nucleotide excision repair     Dmoj_GI24021  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:dmo03021]     Dmoj_GI24021    03400 DNA repair and recombination proteins [BR:dmo03400]     Dmoj_GI24021 Transcription machinery [BR:dmo03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      Dmoj_GI24021   RNA polymerase III system    RNA polymerase III      Dmoj_GI24021   RNA polymerase I system    RNA polymerase I      Dmoj_GI24021 DNA repair and recombination proteins [BR:dmo03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       Dmoj_GI24021 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_N Chordopox_RPO7 Motif Other DBs NCBI-ProteinID:  EDW13987 UniProt:  B4K516 LinkDB All DBs AA seq 67 aa AA seqDB search MIIPIRCFTCGKVIGNKWESYLGLLQAEYTEGDALDALGLKRYCCRRMLLGHVDLIEKLL NYAPLEK NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgataataccaattcggtgttttacctgtggcaaagttattggtaacaaatgggaatct tacctaggcttgctacaggctgagtatacggaaggtgacgcattggatgctttaggatta aagcgttattgttgccgtcgaatgctgcttggccatgtggatctcattgagaagcttctc aactatgcacctctcgaaaagtaa

DBGET integrated database retrieval system