Desulfoferula mesophila: FAK_04850 Help Entry FAK_04850         CDS       T09861                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism dmp  Desulfoferula mesophila Pathway dmp00020   Citrate cycle (TCA cycle) dmp00720   Other carbon fixation pathways dmp01100   Metabolic pathways dmp01110   Biosynthesis of secondary metabolites dmp01120   Microbial metabolism in diverse environments dmp01200   Carbon metabolism dmp01210   2-Oxocarboxylic acid metabolism Module dmp_M00009   Citrate cycle (TCA cycle, Krebs cycle) dmp_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:dmp00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     FAK_04850   09102 Energy metabolism    00720 Other carbon fixation pathways     FAK_04850 Enzymes [BR:dmp01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      FAK_04850 SSDB OrthologParalogGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_2 Fer4_10 Fer4_16 Fer4_9 Fer4_4 Fer4_8 Fer4_6 Fer4_21 Fer4_3 Fer4_17 LdpA_Fe-S-bd UGSC zf_Tbcl Fer4_15 Motif Other DBs NCBI-ProteinID:  BEQ13419 UniProt:  A0AAU9EJI6 LinkDB All DBs Position complement(524907..525257) Genome browser AA seq 116 aa AA seqDB search MTPRKKKAEAKAAPAAIQPEQHKVSFYPAWCKRCGNCSSFCPRDALATDEWGYPFLARPD RCTSCGLCEMLCPDFAISLGEPEPGAAVSPGARCQRPSQPANISPERLAPAPREDN NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgacccccaggaagaaaaaggcggaggccaaggcggcccccgccgcgatccagcccgag cagcacaaggtcagcttttaccccgcctggtgcaagcgctgcggcaactgctcctctttc tgcccccgcgacgccctggccaccgacgagtggggctatcccttcctggctcggccggac cgctgcaccagctgcggcctgtgcgaaatgctttgcccggactttgccatcagcctgggc gagcccgagcccggcgccgccgtgtctccgggggcgcgctgccagcggccctcccagccg gccaatataagccccgagcgcctggccccggcgccccgcgaagacaactga

DBGET integrated database retrieval system