KEGG   Desulfoferula mesophila: FAK_33370
Entry
FAK_33370         CDS       T09861                                 
Name
(GenBank) peptidase S66
  KO
K01297  muramoyltetrapeptide carboxypeptidase [EC:3.4.17.13]
Organism
dmp  Desulfoferula mesophila
Brite
KEGG Orthology (KO) [BR:dmp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dmp01002]
    FAK_33370
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dmp01011]
    FAK_33370
Enzymes [BR:dmp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.13  muramoyltetrapeptide carboxypeptidase
     FAK_33370
Peptidases and inhibitors [BR:dmp01002]
 Serine peptidases
  Family S66
   FAK_33370
Peptidoglycan biosynthesis and degradation proteins [BR:dmp01011]
 Precursor biosynthesis
  Carboxypeptidase
   FAK_33370
SSDB
Motif
Pfam: Peptidase_S66C Peptidase_S66
Other DBs
NCBI-ProteinID: BEQ16271
UniProt: A0AAU9EQZ4
LinkDB
Position
3594167..3595072
AA seq 301 aa
MMAALSPRWPAPGLPLAVVAPAGRVAPDALEAGLAALAELAPGCRVDCPPAVTASLDYLA
GPDEERAANLNELMRDSSLGAVIAARGGFGCLRLLPLLDLAALARSKTCLIGFSDLTALL
NPLAALGLVTLHGPVVTQIPRLDQASRADLAALLAGRRPWPAALNGRGLTGGRATGPLMG
GNLTTLCSLLGTPWFPELTGAVLILEDSGEAPYRLDRLISQLEFSGALAQVAGVAVGRLG
DQGSDPPGAAPALTRRLEGLGKPVVMGLPFGHGAANRLLPLGALAELDGGAGTLSVGLNL
A
NT seq 906 nt   +upstreamnt  +downstreamnt
atgatggccgcgctctcgccccgctggcccgcccccggccttcccctggccgtggtcgct
ccggccgggcgggtggctcccgacgccctggaagcgggtctggccgccctggccgaattg
gccccgggctgccgggtggattgccccccggccgtaacggcttccctggactacctggcc
gggccggacgaagagcgcgccgccaacttgaacgagttgatgcgagactccagcctgggg
gcggtgatcgccgcgcggggcggcttcggctgcctgcgcctgttgccccttttggacttg
gccgccctggcccgaagcaagacctgcctcatcggtttttccgacctcaccgccctcctg
aaccccctggccgccctggggctcgtaaccctgcacgggccggtggtgacccaaatcccc
cgcctggatcaggccagccgggccgacctggccgccttgttggcgggacgccgcccctgg
cccgccgccctgaacggccggggcctgaccggcggccgggccacgggacctctgatgggc
ggcaacctcaccaccctgtgcagccttttgggcaccccctggttcccggagctcaccggc
gcggtgctcatcctggaggacagtggagaggccccctaccgcttggaccggctcatcagc
cagctggaattcagcggagccctggcccaggtggccggggtggcggtgggccgcctcggc
gaccaggggagcgacccaccgggggcggccccggccctgacccggcgcctggagggcctg
ggcaagccggtggtgatgggcctgccctttggccacggcgcggccaaccgcctgttgccc
ctgggggccctggccgagttggacggcggggccggcaccctgagcgtggggctgaacctt
gcctga

DBGET integrated database retrieval system