Desulfoferula mesophila: FAK_35710 Help Entry FAK_35710         CDS       T09861                                  Name (GenBank) hypothetical protein   KO K03060   DNA-directed RNA polymerase subunit omega [EC:2.7.7.6] Organism dmp  Desulfoferula mesophila Pathway dmp03020   RNA polymerase Brite KEGG Orthology (KO) [BR:dmp00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     FAK_35710  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:dmp03021]     FAK_35710    03400 DNA repair and recombination proteins [BR:dmp03400]     FAK_35710 Enzymes [BR:dmp01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.6  DNA-directed RNA polymerase      FAK_35710 Transcription machinery [BR:dmp03021]  Prokaryotic type   Bacterial type    RNA polymerase     Core subunits      FAK_35710 DNA repair and recombination proteins [BR:dmp03400]  Prokaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase complex (RNAP)       FAK_35710 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_Rpb6 DUF4266 Tfb4 Motif Other DBs NCBI-ProteinID:  BEQ16505 UniProt:  A0AAU9EKL1 LinkDB All DBs Position 3839342..3839677 Genome browser AA seq 111 aa AA seqDB search MARVTVEDCLREVPNRFSLVHLTAKRVRQLREGAPPMIPVKNKEVVVALREIAAGYVYPV SAAEAEKERAEAEARERDRLAQAQMALEAAALAEETAEEVDEAEEDEESKD NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggctcgagtaacggtggaagattgcctcagagaggtgcccaaccgcttttcgttggtg catctgacggccaagcgggtgcgccagctgcgggagggcgctccgcccatgatcccggtg aagaacaaagaggtggtggtggccctgcgcgagatcgcggcgggttacgtatacccggtt agcgccgccgaggccgagaaggagcgcgccgaggccgaggcccgcgagcgcgaccgcctg gcccaggcccagatggccctggaggccgccgccctggccgaagagaccgccgaagaggtg gacgaggccgaagaggacgaggaatccaaggactag

DBGET integrated database retrieval system