KEGG   Desulfoferula mesophila: FAK_35930
Entry
FAK_35930         CDS       T09861                                 
Symbol
rplR
Name
(GenBank) 50S ribosomal protein L18
  KO
K02881  large subunit ribosomal protein L18
Organism
dmp  Desulfoferula mesophila
Pathway
dmp03010  Ribosome
Brite
KEGG Orthology (KO) [BR:dmp00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    FAK_35930 (rplR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dmp03011]
    FAK_35930 (rplR)
Ribosome [BR:dmp03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    FAK_35930 (rplR)
  Bacteria
    FAK_35930 (rplR)
  Archaea
    FAK_35930 (rplR)
SSDB
Motif
Pfam: Ribosomal_L18p Formyl_trans_C
Other DBs
NCBI-ProteinID: BEQ16527
UniProt: A0AAU9F504
LinkDB
Position
complement(3858805..3859173)
AA seq 122 aa
MGKTSKRKVAWAKRKVRVRRKVRGTSERPRLCVFRSLNNIYVQIIDDEQGNTLAAASSLP
QELSGHEGHRGNLETAKKVGAAIAAKAQAKGIKQVVFDRNGFLYHGRVKALAEAAREAGL
DF
NT seq 369 nt   +upstreamnt  +downstreamnt
atgggtaagacctccaagagaaaagtcgcctgggccaagcgcaaggtgcgggtgcgccgc
aaggtgcgcggcaccagtgaacgcccccggctgtgcgttttccgatccttgaacaacatc
tatgtgcaaatcatagacgatgaacaaggcaacaccttggcggcggcgagcagcctgccc
caggagttgagcggacacgaaggacaccggggcaacctggaaaccgccaagaaggtgggc
gcggccatagcggccaaggcccaggccaagggcatcaagcaggtggttttcgaccgcaac
ggatttttgtaccacggccgggtgaaagctctggccgaggcggcccgcgaagcgggtctg
gatttctag

DBGET integrated database retrieval system