Oceanidesulfovibrio marinus: E8L03_06610 Help Entry E8L03_06610       CDS       T06743                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dms  Oceanidesulfovibrio marinus Pathway dms01100   Metabolic pathways dms01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dms00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     E8L03_06610    00074 Mycolic acid biosynthesis     E8L03_06610   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     E8L03_06610 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N DUF1493 Motif Other DBs NCBI-ProteinID:  QJT08614 UniProt:  A0A6P1ZI38 LinkDB All DBs Position 1478772..1479002 Genome browser AA seq 76 aa AA seqDB search MSVQEKVTKIIIDQLGVSADEVKPEASFVDDLNADSLDITELIMAMEEEFGLEIDDDDAQ SMLTVKDAISYIESKQ NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgtccgttcaagagaaagtgaccaagatcatcatcgaccagctgggcgtctccgccgac gaagtcaagcccgaggcctctttcgttgacgacctcaacgccgattccctcgacatcacc gagctcatcatggcaatggaagaggaattcggcctcgagatcgacgacgatgacgcccag tctatgctgacggtgaaagacgccatcagctatatcgaaagcaagcagtag

DBGET integrated database retrieval system