Dromaius novaehollandiae (emu): 112978921 Help Entry 112978921         CDS       T07572                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism dne  Dromaius novaehollandiae (emu) Pathway dne04010   MAPK signaling pathway dne04068   FoxO signaling pathway dne04081   Hormone signaling dne04114   Oocyte meiosis dne04140   Autophagy - animal dne04150   mTOR signaling pathway dne04810   Regulation of actin cytoskeleton dne04910   Insulin signaling pathway dne04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:dne00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     112978921 (INS)    04068 FoxO signaling pathway     112978921 (INS)    04150 mTOR signaling pathway     112978921 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     112978921 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     112978921 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     112978921 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     112978921 (INS)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     112978921 (INS)    04914 Progesterone-mediated oocyte maturation     112978921 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dne04052]     112978921 (INS) Cytokines and neuropeptides [BR:dne04052]  Neuropeptides   Unclassified    112978921 (INS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  112978921 NCBI-ProteinID:  XP_025948497 Ensembl:  ENSDNVG00000014190 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MALWIRSLPLLALLALSGPGTSQAAANQHLCGSHLVEALYLVCGERGFFYSPKARRDAEQ PLVSGPLRGEAEELPFQQEEYEKVKRGIVEQCCHNTCSLYQLENYCN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggctctctggatccgatccctgcctctcctagcccttcttgctctttctggccctggg accagccaggcagctgccaaccagcacctctgcggctcccacttggtggaggctctctac ctggtgtgtggggagcggggtttcttctactcccccaaagcccggcgggacgctgagcag cctctggtgagcgggccattgcgtggcgaggctgaagagctgccgttccagcaggaggaa tacgagaaagtgaagagaggaattgttgagcaatgctgccataacacgtgctccctctac caactggaaaactattgcaactag

DBGET integrated database retrieval system