Dromaius novaehollandiae (emu): 112981307 Help Entry 112981307         CDS       T07572                                  Symbol IL12A Name (RefSeq) interleukin-12 subunit alpha   KO K05406   interleukin 12A Organism dne  Dromaius novaehollandiae (emu) Pathway dne04060   Cytokine-cytokine receptor interaction dne04620   Toll-like receptor signaling pathway dne04622   RIG-I-like receptor signaling pathway dne04625   C-type lectin receptor signaling pathway dne05164   Influenza A dne05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:dne00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112981307 (IL12A)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     112981307 (IL12A)    04622 RIG-I-like receptor signaling pathway     112981307 (IL12A)    04625 C-type lectin receptor signaling pathway     112981307 (IL12A)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     112981307 (IL12A)    05168 Herpes simplex virus 1 infection     112981307 (IL12A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dne04052]     112981307 (IL12A)    00536 Glycosaminoglycan binding proteins [BR:dne00536]     112981307 (IL12A) Cytokines and neuropeptides [BR:dne04052]  Cytokines   Interleukins    112981307 (IL12A) Glycosaminoglycan binding proteins [BR:dne00536]  Heparan sulfate / Heparin   Cytokines    112981307 (IL12A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL12 Motif Other DBs NCBI-GeneID:  112981307 NCBI-ProteinID:  XP_025952630 LinkDB All DBs Position Unknown AA seq 146 aa AA seqDB search FFFFSTQAFNTLGFECTLEELDLEDITENHINTIKACTSEDSGAGNCPALEGPAFDTNKC LRGIYEDLKVYRAELKNFNDPEVLTTIDEMMKALRIGSTSVLQPSANAALTFKERMRLCS VLHAFRIRAVTINRMMNYLTALESSL NT seq 441 nt NT seq  +upstreamnt  +downstreamnt ttcttcttcttttccacacaggcgtttaacacactaggatttgagtgcacccttgaagag cttgatcttgaagatatcactgagaatcacatcaacacgataaaagcttgtacatccgag gattcgggggctggaaactgcccagcactggaaggacctgcttttgatacgaataaatgc ctgcgaggtatctatgaagatctgaaggtctacagggcagagctgaagaatttcaatgat ccagaggtgttgacaactatcgatgagatgatgaaagctctgaggatcggcagcaccagc gtgctgcagccgtcggcaaacgcagccttgactttcaaagagaggatgagactctgcagy gtgcttcatgctttccgaatccgcgctgtgaccatcaacaggatgatgaactacctgacc gctctggagagctcgctgtga

DBGET integrated database retrieval system