Dromaius novaehollandiae (emu): 112984913 Help Entry 112984913         CDS       T07572                                  Symbol TXN Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism dne  Dromaius novaehollandiae (emu) Pathway dne04621   NOD-like receptor signaling pathway dne05132   Salmonella infection Brite KEGG Orthology (KO) [BR:dne00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     112984913 (TXN)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112984913 (TXN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:dne03110]     112984913 (TXN) Chaperones and folding catalysts [BR:dne03110]  Protein folding catalysts   Protein disulfide isomerase    112984913 (TXN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 AhpC-TSA Thioredoxin_2 DIM1 OST3_OST6 Thioredoxin_9 Thioredoxin_7 Glutaredoxin Redoxin Motif Other DBs NCBI-GeneID:  112984913 NCBI-ProteinID:  XP_025958919 Ensembl:  ENSDNVG00000017139 UniProt:  A0A8C4KHT6 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MVKTVGSLAEFEEELKSAGEKLVVVDFSATWCGPCKMIKPFFHSLCEKFADVVFIEIDVD DAQDVAAHCDVKCMPTFQFYKNGKKVQEFSGANKEKLEETIKHLV NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagaccgtgggcagcctggcagaatttgaggaagaactgaaatctgctggtgag aagcttgttgttgttgatttctctgccacatggtgtggaccttgcaaaatgatcaaaccc ttcttccayagtttgtgtgagaagtttgctgatgtggtattcatcgaaattgatgtggat gatgctcaggatgttgctgcacactgtgatgtcaagtgcatgcccacgttccagttctac aagaatggaaagaaggtgcaggagttctctggggccaataaagagaagctggaagagacc attaaacatctagtctaa

DBGET integrated database retrieval system