Dromaius novaehollandiae (emu): 112988276 Help Entry 112988276         CDS       T07572                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism dne  Dromaius novaehollandiae (emu) Pathway dne04060   Cytokine-cytokine receptor interaction dne04218   Cellular senescence dne04620   Toll-like receptor signaling pathway dne04621   NOD-like receptor signaling pathway dne04622   RIG-I-like receptor signaling pathway dne05132   Salmonella infection dne05164   Influenza A Brite KEGG Orthology (KO) [BR:dne00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112988276  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     112988276  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     112988276    04621 NOD-like receptor signaling pathway     112988276    04622 RIG-I-like receptor signaling pathway     112988276  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     112988276   09171 Infectious disease: bacterial    05132 Salmonella infection     112988276  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dne04052]     112988276    00536 Glycosaminoglycan binding proteins [BR:dne00536]     112988276 Cytokines and neuropeptides [BR:dne04052]  Cytokines   Chemokines    112988276 Glycosaminoglycan binding proteins [BR:dne00536]  Heparan sulfate / Heparin   Chemokines    112988276 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  112988276 NCBI-ProteinID:  XP_025964453 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MNXKLVAVLALLLVSAAVSQGRALARMANELRCQCITTHSKLIHPKSIQGVKLTQSGPHC KNVEVIATLKDGREVCLEPTAPWVQLIVKTILAKAQFNTDTPL NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgaacgkcaaacttgtggctgtcctggctcttctcctggtctcagcagctgtgtctcaa ggtagggccctggcaaggatggcaaacgagctccggtgccagtgcataaccactcattca aagctcatccaccctaaatccattcaaggtgtaaagctgacgcaaagcggacctcactgc aagaacgtggaagtcatagctactctgaaggatggcagagaagtgtgtttggagcccacc gctccctgggttcagctgattgtaaagacaattttggccaaggctcaattcaatactgat acaccactctaa

DBGET integrated database retrieval system