Dromaius novaehollandiae (emu): 112989107 Help Entry 112989107         CDS       T07572                                  Symbol PFN2 Name (RefSeq) profilin-2   KO K05759   profilin Organism dne  Dromaius novaehollandiae (emu) Pathway dne04810   Regulation of actin cytoskeleton dne05132   Salmonella infection Brite KEGG Orthology (KO) [BR:dne00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     112989107 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112989107 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dne04131]     112989107 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:dne04812]     112989107 (PFN2)    04147 Exosome [BR:dne04147]     112989107 (PFN2) Membrane trafficking [BR:dne04131]  Others   Actin-binding proteins    Others     112989107 (PFN2) Cytoskeleton proteins [BR:dne04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      112989107 (PFN2) Exosome [BR:dne04147]  Exosomal proteins   Proteins found in most exosomes    112989107 (PFN2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  112989107 NCBI-ProteinID:  XP_025965811 Ensembl:  ENSDNVG00000007760 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search QPVEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAV GRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF NT seq 294 nt NT seq  +upstreamnt  +downstreamnt cagccagtagaaatagatatgattgtaggaaaagaccgagaggggttcttcaccaacggt ctgacccttggcgcaaagaagtgctctgtgatcagagatagcctgtacgttgatggcgac tgcacaatggacatcaggacaaagagtcaaggtggtgagccaacgtacaacgttgctgta ggcagagctggccgagtcttggtctttgtaatgggcaaagaaggggtccatggaggcgga ttgaataagaaggcatactcaatggcaaaatacttgagagactctgggttctag

DBGET integrated database retrieval system