Dromaius novaehollandiae (emu): 112990244 Help Entry 112990244         CDS       T07572                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism dne  Dromaius novaehollandiae (emu) Pathway dne04010   MAPK signaling pathway dne04012   ErbB signaling pathway dne04068   FoxO signaling pathway dne04137   Mitophagy - animal dne04140   Autophagy - animal dne04150   mTOR signaling pathway dne04210   Apoptosis dne04218   Cellular senescence dne04370   VEGF signaling pathway dne04371   Apelin signaling pathway dne04540   Gap junction dne04625   C-type lectin receptor signaling pathway dne04810   Regulation of actin cytoskeleton dne04910   Insulin signaling pathway dne04912   GnRH signaling pathway dne04916   Melanogenesis Brite KEGG Orthology (KO) [BR:dne00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     112990244 (NRAS)    04012 ErbB signaling pathway     112990244 (NRAS)    04370 VEGF signaling pathway     112990244 (NRAS)    04371 Apelin signaling pathway     112990244 (NRAS)    04068 FoxO signaling pathway     112990244 (NRAS)    04150 mTOR signaling pathway     112990244 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     112990244 (NRAS)    04137 Mitophagy - animal     112990244 (NRAS)   09143 Cell growth and death    04210 Apoptosis     112990244 (NRAS)    04218 Cellular senescence     112990244 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     112990244 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     112990244 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     112990244 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     112990244 (NRAS)    04912 GnRH signaling pathway     112990244 (NRAS)    04916 Melanogenesis     112990244 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dne04131]     112990244 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dne04147]     112990244 (NRAS)    04031 GTP-binding proteins [BR:dne04031]     112990244 (NRAS) Membrane trafficking [BR:dne04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     112990244 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     112990244 (NRAS) Exosome [BR:dne04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112990244 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    112990244 (NRAS)   Exosomal proteins of breast cancer cells    112990244 (NRAS)   Exosomal proteins of colorectal cancer cells    112990244 (NRAS) GTP-binding proteins [BR:dne04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     112990244 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N ParA Motif Other DBs NCBI-GeneID:  112990244 NCBI-ProteinID:  XP_025967640 Ensembl:  ENSDNVG00000011281 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAQELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSNEDGNQG CMGLSCIVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaagctggtggtggtgggagccggcggcgtcggcaagagtgcgctgacc atccagctcatccagaaccacttcgtggacgagtatgaccccaccatcgaggattcatat agaaagcaagttgttattgatggagaaacatgtttgctagacattctggacaccgctgga caggaagagtatagcgccatgcgtgaccagtacatgagaaccggggaaggattcctctgt gtttttgccattaacaacagtaaatcatttgctgatattaacctttacagagaacagata aagagagtgaaagattcggatgatgtgccaatggtgctggtggggaataaatgtgattta cccacaagaacagtagacacaaaacaggctcaagaattagcaaaaagctatggaatcccc ttcatagagacatcggctaaaacgagacagggcgtggaagatgctttttacacactggtg agagagatccggcagtaccggatgaaaaagctcaacagcaatgaagatgggaatcaaggc tgtatgggattgtcttgtatcgtgatgtga

DBGET integrated database retrieval system