Dromaius novaehollandiae (emu): 112993281 Help Entry 112993281         CDS       T07572                                  Symbol CUNH10orf99 Name (RefSeq) protein GPR15L   KO K25387   protein GPR15L Organism dne  Dromaius novaehollandiae (emu) Brite KEGG Orthology (KO) [BR:dne00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dne04052]     112993281 (CUNH10orf99) Cytokines and neuropeptides [BR:dne04052]  Cytokines   Chemokines    112993281 (CUNH10orf99) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GPR15L GLV1-2 Motif Other DBs NCBI-GeneID:  112993281 NCBI-ProteinID:  XP_025972527 LinkDB All DBs Position Unknown AA seq 78 aa AA seqDB search MKLLVLCSFLFVLLLCFNTFTVEGRKVKKICCSKLPKLNKKAQKGMNPKMTLMEIRKYCK PCPQAAPPVIPGPLPQLK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgaagctgctggtgctctgtagctttttgtttgtcttacttctgtgcttcaacaccttt actgtagaaggtcggaaggttaaaaaaatctgctgctcaaaactacccaaactcaacaaa aaagcacagaaaggtatgaatcccaaaatgactctgatggaaataagaaaatattgcaag ccttgtcctcaggcagcccctccagtgattcctggaccgcttccgcagttgaaatga

DBGET integrated database retrieval system