Dromaius novaehollandiae (emu): 112993695 Help Entry 112993695         CDS       T07572                                  Symbol NPPC Name (RefSeq) C-type natriuretic peptide   KO K12336   natriuretic peptide C Organism dne  Dromaius novaehollandiae (emu) Pathway dne04081   Hormone signaling dne04270   Vascular smooth muscle contraction Brite KEGG Orthology (KO) [BR:dne00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     112993695 (NPPC)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     112993695 (NPPC)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dne04052]     112993695 (NPPC) Cytokines and neuropeptides [BR:dne04052]  Neuropeptides   Unclassified    112993695 (NPPC) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  112993695 NCBI-ProteinID:  XP_025973349 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MHVSPLLAGGLLLALLSARLEAKPASQLPQKGWARLLQDPPARRHKGLHKKGLGKGCFGL KLDRIGAMSGLGC NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgcacgtctcacccttgctggccgggggacttttactcgcgctgctctcggcgaggctg gaggcgaagccggcgtcccagctcccgcagaagggctgggcgcggctgctgcaggacccg ccggcccgccgccacaagggcctccacaagaagggcctcggcaagggctgcttcggcctc aagctggaccgcatcggcgccatgagcggcctcggctgctag

DBGET integrated database retrieval system