Dromaius novaehollandiae (emu): 112995196 Help Entry 112995196         CDS       T07572                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism dne  Dromaius novaehollandiae (emu) Pathway dne04137   Mitophagy - animal dne04140   Autophagy - animal dne04144   Endocytosis dne04145   Phagosome dne04148   Efferocytosis dne05132   Salmonella infection Brite KEGG Orthology (KO) [BR:dne00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     112995196 (RAB7A)    04145 Phagosome     112995196 (RAB7A)    04140 Autophagy - animal     112995196 (RAB7A)    04137 Mitophagy - animal     112995196 (RAB7A)    04148 Efferocytosis     112995196 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112995196 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dne04131]     112995196 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dne04147]     112995196 (RAB7A)    04031 GTP-binding proteins [BR:dne04031]     112995196 (RAB7A) Membrane trafficking [BR:dne04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     112995196 (RAB7A) Exosome [BR:dne04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112995196 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    112995196 (RAB7A)   Exosomal proteins of colorectal cancer cells    112995196 (RAB7A)   Exosomal proteins of bladder cancer cells    112995196 (RAB7A) GTP-binding proteins [BR:dne04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     112995196 (RAB7A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_24 AAA_16 G-alpha AAA_5 ATPase_2 AAA_14 NACHT NB-ARC ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  112995196 NCBI-ProteinID:  XP_025975824 Ensembl:  ENSDNVG00000014626 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRVKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacttctaggaagaaagtgttactgaaagtcatcatccttggagactctggggtggga aagacatcactcatgaaccagtatgtgaacaagaaattcagtaaccagtacaaggctacg ataggtgcagacttcctgacaaaagaggtcatggtggatgacaggctagtgacgatgcag atatgggatacagcaggacaagaacggtttcagtctctgggagttgccttctacagggga gcagactgctgcgtgctggtgttcgatgttacggcccctaacacgttcaaaaccctagac agctggagggacgaattcctcattcaggccagtccaagggatcctgagaactttccttty gttgtgctgggaaacaagattgacctagaaaacagacaagtcaccacaaaacgggcacaa gcctggtgctacagtaaaaacaacatcccctactttgaaaccagtgccaaggaggccatt aatgtggaacaagctttccagacgattgcacgaaatgcacttaaacaggaaaccgaagtg gagctttacaatgaattccccgaacccatcaaactagacaagaatgaccgagtgaaggct tctgcagagagctgcagctgctga

DBGET integrated database retrieval system