Entry |
|
Symbol |
CALM2
|
Name |
|
KO |
|
Organism |
dnm Dasypus novemcinctus (nine-banded armadillo)
|
Pathway |
dnm04070 | Phosphatidylinositol signaling system |
dnm04261 | Adrenergic signaling in cardiomyocytes |
dnm04270 | Vascular smooth muscle contraction |
dnm04625 | C-type lectin receptor signaling pathway |
dnm04750 | Inflammatory mediator regulation of TRP channels |
dnm04925 | Aldosterone synthesis and secretion |
dnm05022 | Pathways of neurodegeneration - multiple diseases |
dnm05163 | Human cytomegalovirus infection |
dnm05167 | Kaposi sarcoma-associated herpesvirus infection |
dnm05170 | Human immunodeficiency virus 1 infection |
dnm05418 | Fluid shear stress and atherosclerosis |
|
Brite |
KEGG Orthology (KO) [BR:dnm00001]
09130 Environmental Information Processing
09132 Signal transduction
04014 Ras signaling pathway
101416595 (CALM2)
04015 Rap1 signaling pathway
101416595 (CALM2)
04371 Apelin signaling pathway
101416595 (CALM2)
04020 Calcium signaling pathway
101416595 (CALM2)
04070 Phosphatidylinositol signaling system
101416595 (CALM2)
04024 cAMP signaling pathway
101416595 (CALM2)
04022 cGMP-PKG signaling pathway
101416595 (CALM2)
09140 Cellular Processes
09143 Cell growth and death
04114 Oocyte meiosis
101416595 (CALM2)
04218 Cellular senescence
101416595 (CALM2)
09150 Organismal Systems
09151 Immune system
04625 C-type lectin receptor signaling pathway
101416595 (CALM2)
09152 Endocrine system
04910 Insulin signaling pathway
101416595 (CALM2)
04922 Glucagon signaling pathway
101416595 (CALM2)
04912 GnRH signaling pathway
101416595 (CALM2)
04915 Estrogen signaling pathway
101416595 (CALM2)
04921 Oxytocin signaling pathway
101416595 (CALM2)
04916 Melanogenesis
101416595 (CALM2)
04924 Renin secretion
101416595 (CALM2)
04925 Aldosterone synthesis and secretion
101416595 (CALM2)
09153 Circulatory system
04261 Adrenergic signaling in cardiomyocytes
101416595 (CALM2)
04270 Vascular smooth muscle contraction
101416595 (CALM2)
09154 Digestive system
04970 Salivary secretion
101416595 (CALM2)
04971 Gastric acid secretion
101416595 (CALM2)
09156 Nervous system
04728 Dopaminergic synapse
101416595 (CALM2)
04720 Long-term potentiation
101416595 (CALM2)
04722 Neurotrophin signaling pathway
101416595 (CALM2)
09157 Sensory system
04744 Phototransduction
101416595 (CALM2)
04740 Olfactory transduction
101416595 (CALM2)
04750 Inflammatory mediator regulation of TRP channels
101416595 (CALM2)
09159 Environmental adaptation
04713 Circadian entrainment
101416595 (CALM2)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
101416595 (CALM2)
09162 Cancer: specific types
05214 Glioma
101416595 (CALM2)
09172 Infectious disease: viral
05170 Human immunodeficiency virus 1 infection
101416595 (CALM2)
05163 Human cytomegalovirus infection
101416595 (CALM2)
05167 Kaposi sarcoma-associated herpesvirus infection
101416595 (CALM2)
09171 Infectious disease: bacterial
05133 Pertussis
101416595 (CALM2)
05152 Tuberculosis
101416595 (CALM2)
09164 Neurodegenerative disease
05010 Alzheimer disease
101416595 (CALM2)
05012 Parkinson disease
101416595 (CALM2)
05022 Pathways of neurodegeneration - multiple diseases
101416595 (CALM2)
09165 Substance dependence
05031 Amphetamine addiction
101416595 (CALM2)
05034 Alcoholism
101416595 (CALM2)
09166 Cardiovascular disease
05417 Lipid and atherosclerosis
101416595 (CALM2)
05418 Fluid shear stress and atherosclerosis
101416595 (CALM2)
09180 Brite Hierarchies
09181 Protein families: metabolism
01009 Protein phosphatases and associated proteins [BR:dnm01009]
101416595 (CALM2)
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:dnm04131]
101416595 (CALM2)
03036 Chromosome and associated proteins [BR:dnm03036]
101416595 (CALM2)
09183 Protein families: signaling and cellular processes
04147 Exosome [BR:dnm04147]
101416595 (CALM2)
Protein phosphatases and associated proteins [BR:dnm01009]
Protein serine/threonine phosphatases
Phosphoprotein phosphatases (PPPs)
Calcineurin (PPP3/ PP2B)
Regulatory subunits
101416595 (CALM2)
Membrane trafficking [BR:dnm04131]
Exocytosis
Small GTPases and associated proteins
Rab associated proteins
101416595 (CALM2)
Chromosome and associated proteins [BR:dnm03036]
Eukaryotic type
Centrosome formation proteins
Centrosome duplication proteins
Centriole replication proteins
101416595 (CALM2)
Exosome [BR:dnm04147]
Exosomal proteins
Exosomal proteins of colorectal cancer cells
101416595 (CALM2)
|
SSDB |
|
Motif |
|
Other DBs |
|
LinkDB |
|
Position |
Unknown
|
AA seq |
113 aa
MRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKD
GNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK |
NT seq |
342 nt +upstreamnt +downstreamnt
atgaggtctcttgggcagaatcccacagaagcggagttacaggacatgatcaatgaagtc
gatgctgatggtaatggcacaattgactttcctgaatttctgactatgatggcaaggaaa
atgaaagacacagacagtgaagaagaaattagagaagcattccgtgtatttgataaggat
ggcaatggctatattagtgcagcagagcttcgccatgtgatgacaaaccttggagagaag
ttaacagatgaagaggttgatgaaatgatcagggaagcagatattgatggtgatggtcaa
gtaaactatgaagagtttgtacaaatgatgacagcaaagtga |