Entry |
|
Symbol |
PRKACB
|
Name |
(RefSeq) LOW QUALITY PROTEIN: cAMP-dependent protein kinase catalytic subunit beta
|
KO |
|
Organism |
dnm Dasypus novemcinctus (nine-banded armadillo)
|
Pathway |
dnm04213 | Longevity regulating pathway - multiple species |
dnm04261 | Adrenergic signaling in cardiomyocytes |
dnm04270 | Vascular smooth muscle contraction |
dnm04723 | Retrograde endocannabinoid signaling |
dnm04750 | Inflammatory mediator regulation of TRP channels |
dnm04914 | Progesterone-mediated oocyte maturation |
dnm04919 | Thyroid hormone signaling pathway |
dnm04923 | Regulation of lipolysis in adipocytes |
dnm04925 | Aldosterone synthesis and secretion |
dnm04927 | Cortisol synthesis and secretion |
dnm04928 | Parathyroid hormone synthesis, secretion and action |
dnm04935 | Growth hormone synthesis, secretion and action |
dnm04961 | Endocrine and other factor-regulated calcium reabsorption |
dnm04962 | Vasopressin-regulated water reabsorption |
dnm05163 | Human cytomegalovirus infection |
dnm05166 | Human T-cell leukemia virus 1 infection |
dnm05207 | Chemical carcinogenesis - receptor activation |
|
Brite |
KEGG Orthology (KO) [BR:dnm00001]
09130 Environmental Information Processing
09132 Signal transduction
04010 MAPK signaling pathway
101423692 (PRKACB)
04014 Ras signaling pathway
101423692 (PRKACB)
04310 Wnt signaling pathway
101423692 (PRKACB)
04340 Hedgehog signaling pathway
101423692 (PRKACB)
04371 Apelin signaling pathway
101423692 (PRKACB)
04020 Calcium signaling pathway
101423692 (PRKACB)
04024 cAMP signaling pathway
101423692 (PRKACB)
09133 Signaling molecules and interaction
04082 Neuroactive ligand signaling
101423692 (PRKACB)
04081 Hormone signaling
101423692 (PRKACB)
09140 Cellular Processes
09141 Transport and catabolism
04140 Autophagy - animal
101423692 (PRKACB)
09143 Cell growth and death
04114 Oocyte meiosis
101423692 (PRKACB)
09144 Cellular community - eukaryotes
04530 Tight junction
101423692 (PRKACB)
04540 Gap junction
101423692 (PRKACB)
09150 Organismal Systems
09151 Immune system
04611 Platelet activation
101423692 (PRKACB)
04062 Chemokine signaling pathway
101423692 (PRKACB)
09152 Endocrine system
04911 Insulin secretion
101423692 (PRKACB)
04910 Insulin signaling pathway
101423692 (PRKACB)
04922 Glucagon signaling pathway
101423692 (PRKACB)
04923 Regulation of lipolysis in adipocytes
101423692 (PRKACB)
04912 GnRH signaling pathway
101423692 (PRKACB)
04913 Ovarian steroidogenesis
101423692 (PRKACB)
04915 Estrogen signaling pathway
101423692 (PRKACB)
04914 Progesterone-mediated oocyte maturation
101423692 (PRKACB)
04921 Oxytocin signaling pathway
101423692 (PRKACB)
04926 Relaxin signaling pathway
101423692 (PRKACB)
04935 Growth hormone synthesis, secretion and action
101423692 (PRKACB)
04918 Thyroid hormone synthesis
101423692 (PRKACB)
04919 Thyroid hormone signaling pathway
101423692 (PRKACB)
04928 Parathyroid hormone synthesis, secretion and action
101423692 (PRKACB)
04916 Melanogenesis
101423692 (PRKACB)
04924 Renin secretion
101423692 (PRKACB)
04925 Aldosterone synthesis and secretion
101423692 (PRKACB)
04927 Cortisol synthesis and secretion
101423692 (PRKACB)
09153 Circulatory system
04261 Adrenergic signaling in cardiomyocytes
101423692 (PRKACB)
04270 Vascular smooth muscle contraction
101423692 (PRKACB)
09154 Digestive system
04970 Salivary secretion
101423692 (PRKACB)
04971 Gastric acid secretion
101423692 (PRKACB)
04976 Bile secretion
101423692 (PRKACB)
09155 Excretory system
04962 Vasopressin-regulated water reabsorption
101423692 (PRKACB)
04961 Endocrine and other factor-regulated calcium reabsorption
101423692 (PRKACB)
09156 Nervous system
04724 Glutamatergic synapse
101423692 (PRKACB)
04727 GABAergic synapse
101423692 (PRKACB)
04725 Cholinergic synapse
101423692 (PRKACB)
04728 Dopaminergic synapse
101423692 (PRKACB)
04726 Serotonergic synapse
101423692 (PRKACB)
04720 Long-term potentiation
101423692 (PRKACB)
04723 Retrograde endocannabinoid signaling
101423692 (PRKACB)
09157 Sensory system
04740 Olfactory transduction
101423692 (PRKACB)
04742 Taste transduction
101423692 (PRKACB)
04750 Inflammatory mediator regulation of TRP channels
101423692 (PRKACB)
09149 Aging
04211 Longevity regulating pathway
101423692 (PRKACB)
04213 Longevity regulating pathway - multiple species
101423692 (PRKACB)
09159 Environmental adaptation
04713 Circadian entrainment
101423692 (PRKACB)
04714 Thermogenesis
101423692 (PRKACB)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
101423692 (PRKACB)
05205 Proteoglycans in cancer
101423692 (PRKACB)
05207 Chemical carcinogenesis - receptor activation
101423692 (PRKACB)
05203 Viral carcinogenesis
101423692 (PRKACB)
09172 Infectious disease: viral
05166 Human T-cell leukemia virus 1 infection
101423692 (PRKACB)
05163 Human cytomegalovirus infection
101423692 (PRKACB)
05165 Human papillomavirus infection
101423692 (PRKACB)
09174 Infectious disease: parasitic
05146 Amoebiasis
101423692 (PRKACB)
09164 Neurodegenerative disease
05012 Parkinson disease
101423692 (PRKACB)
05020 Prion disease
101423692 (PRKACB)
09165 Substance dependence
05030 Cocaine addiction
101423692 (PRKACB)
05031 Amphetamine addiction
101423692 (PRKACB)
05032 Morphine addiction
101423692 (PRKACB)
05034 Alcoholism
101423692 (PRKACB)
09166 Cardiovascular disease
05414 Dilated cardiomyopathy
101423692 (PRKACB)
09167 Endocrine and metabolic disease
04934 Cushing syndrome
101423692 (PRKACB)
09176 Drug resistance: antineoplastic
01522 Endocrine resistance
101423692 (PRKACB)
09180 Brite Hierarchies
09181 Protein families: metabolism
01001 Protein kinases [BR:dnm01001]
101423692 (PRKACB)
09182 Protein families: genetic information processing
03019 Messenger RNA biogenesis [BR:dnm03019]
101423692 (PRKACB)
03036 Chromosome and associated proteins [BR:dnm03036]
101423692 (PRKACB)
Enzymes [BR:dnm01000]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.11 Protein-serine/threonine kinases
2.7.11.11 cAMP-dependent protein kinase
101423692 (PRKACB)
Protein kinases [BR:dnm01001]
Serine/threonine kinases: AGC group
PKA family
101423692 (PRKACB)
Messenger RNA biogenesis [BR:dnm03019]
Eukaryotic type
mRNA surveillance and transport factors
mRNA cycle factors
Common to processing body (P body) and stress granule
101423692 (PRKACB)
Chromosome and associated proteins [BR:dnm03036]
Eukaryotic type
Centrosome formation proteins
Kinases and associated factors
101423692 (PRKACB)
|
SSDB |
|
Motif |
|
Other DBs |
|
LinkDB |
|
Position |
Unknown
|
AA seq |
281 aa
MLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYSFKDNSNLY
MVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQ
GYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPP
FFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWF
ATTDWIAIYQRKVEAPFIPKFRGLGIPATSMTTKKKISVSL |
NT seq |
846 nt +upstreamnt +downstreamnt
atgttggtgaaacataaagccactgaacagtattatgccatgaagatcttagataagcag
aaggttgttaaactgaagcaaatagagcatactttgaatgagaaaagaatattacaggca
gtgaattttccttttcttgttcgactggagtattcttttaaggataattctaatttatac
atggtaatggaatatgtccctgggggtgaaatgttttcacacctaagaagaattggaagg
ttcagtgagccccatgcacggttctatgcagctcagatagttctaacatttgagtacctc
cattcactagacctcatctacagagatctaaaacctgaaaatctcttaattgaccatcaa
ggttatatccaggtcacagactttgggtttgccaaaagagttaaaggcagaacttggaca
ttatgtggaactccagaatatttggctccagaaataatcttgagcaagggctacaataag
gcagtggattggtgggctttaggagtgttaatctatgaaatggcagctggctaccctcca
ttctttgcagaccaaccaatacagatttatgaaaagattgtttctggaaaggtccgattc
ccatcccacttcagttcagatctcaaggatcttctaaggaacctactccaggtggatttg
accaagcggtttggaaatctgaagaatggagtgagtgacataaaaactcacaagtggttt
gccacaacagattggattgctatttaccagaggaaggttgaagctccattcataccaaag
ttcagaggtctggggataccagcaacttcgatgactacgaagaagaagatatccgtgtct
ctataa |