KEGG   Dasypus novemcinctus (nine-banded armadillo): 101430570
Entry
101430570         CDS       T07872                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
dnm  Dasypus novemcinctus (nine-banded armadillo)
Pathway
dnm01521  EGFR tyrosine kinase inhibitor resistance
dnm01522  Endocrine resistance
dnm01524  Platinum drug resistance
dnm04010  MAPK signaling pathway
dnm04012  ErbB signaling pathway
dnm04014  Ras signaling pathway
dnm04015  Rap1 signaling pathway
dnm04022  cGMP-PKG signaling pathway
dnm04024  cAMP signaling pathway
dnm04062  Chemokine signaling pathway
dnm04066  HIF-1 signaling pathway
dnm04068  FoxO signaling pathway
dnm04071  Sphingolipid signaling pathway
dnm04072  Phospholipase D signaling pathway
dnm04114  Oocyte meiosis
dnm04140  Autophagy - animal
dnm04148  Efferocytosis
dnm04150  mTOR signaling pathway
dnm04151  PI3K-Akt signaling pathway
dnm04210  Apoptosis
dnm04218  Cellular senescence
dnm04261  Adrenergic signaling in cardiomyocytes
dnm04270  Vascular smooth muscle contraction
dnm04350  TGF-beta signaling pathway
dnm04360  Axon guidance
dnm04370  VEGF signaling pathway
dnm04371  Apelin signaling pathway
dnm04380  Osteoclast differentiation
dnm04510  Focal adhesion
dnm04520  Adherens junction
dnm04540  Gap junction
dnm04550  Signaling pathways regulating pluripotency of stem cells
dnm04611  Platelet activation
dnm04613  Neutrophil extracellular trap formation
dnm04620  Toll-like receptor signaling pathway
dnm04621  NOD-like receptor signaling pathway
dnm04625  C-type lectin receptor signaling pathway
dnm04650  Natural killer cell mediated cytotoxicity
dnm04657  IL-17 signaling pathway
dnm04658  Th1 and Th2 cell differentiation
dnm04659  Th17 cell differentiation
dnm04660  T cell receptor signaling pathway
dnm04662  B cell receptor signaling pathway
dnm04664  Fc epsilon RI signaling pathway
dnm04666  Fc gamma R-mediated phagocytosis
dnm04668  TNF signaling pathway
dnm04713  Circadian entrainment
dnm04720  Long-term potentiation
dnm04722  Neurotrophin signaling pathway
dnm04723  Retrograde endocannabinoid signaling
dnm04724  Glutamatergic synapse
dnm04725  Cholinergic synapse
dnm04726  Serotonergic synapse
dnm04730  Long-term depression
dnm04810  Regulation of actin cytoskeleton
dnm04910  Insulin signaling pathway
dnm04912  GnRH signaling pathway
dnm04914  Progesterone-mediated oocyte maturation
dnm04915  Estrogen signaling pathway
dnm04916  Melanogenesis
dnm04917  Prolactin signaling pathway
dnm04919  Thyroid hormone signaling pathway
dnm04921  Oxytocin signaling pathway
dnm04926  Relaxin signaling pathway
dnm04928  Parathyroid hormone synthesis, secretion and action
dnm04929  GnRH secretion
dnm04930  Type II diabetes mellitus
dnm04933  AGE-RAGE signaling pathway in diabetic complications
dnm04934  Cushing syndrome
dnm04935  Growth hormone synthesis, secretion and action
dnm04960  Aldosterone-regulated sodium reabsorption
dnm05010  Alzheimer disease
dnm05020  Prion disease
dnm05022  Pathways of neurodegeneration - multiple diseases
dnm05034  Alcoholism
dnm05132  Salmonella infection
dnm05133  Pertussis
dnm05135  Yersinia infection
dnm05140  Leishmaniasis
dnm05142  Chagas disease
dnm05145  Toxoplasmosis
dnm05152  Tuberculosis
dnm05160  Hepatitis C
dnm05161  Hepatitis B
dnm05163  Human cytomegalovirus infection
dnm05164  Influenza A
dnm05165  Human papillomavirus infection
dnm05166  Human T-cell leukemia virus 1 infection
dnm05167  Kaposi sarcoma-associated herpesvirus infection
dnm05170  Human immunodeficiency virus 1 infection
dnm05171  Coronavirus disease - COVID-19
dnm05200  Pathways in cancer
dnm05203  Viral carcinogenesis
dnm05205  Proteoglycans in cancer
dnm05206  MicroRNAs in cancer
dnm05207  Chemical carcinogenesis - receptor activation
dnm05208  Chemical carcinogenesis - reactive oxygen species
dnm05210  Colorectal cancer
dnm05211  Renal cell carcinoma
dnm05212  Pancreatic cancer
dnm05213  Endometrial cancer
dnm05214  Glioma
dnm05215  Prostate cancer
dnm05216  Thyroid cancer
dnm05218  Melanoma
dnm05219  Bladder cancer
dnm05220  Chronic myeloid leukemia
dnm05221  Acute myeloid leukemia
dnm05223  Non-small cell lung cancer
dnm05224  Breast cancer
dnm05225  Hepatocellular carcinoma
dnm05226  Gastric cancer
dnm05230  Central carbon metabolism in cancer
dnm05231  Choline metabolism in cancer
dnm05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dnm05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dnm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101430570 (MAPK1)
   04012 ErbB signaling pathway
    101430570 (MAPK1)
   04014 Ras signaling pathway
    101430570 (MAPK1)
   04015 Rap1 signaling pathway
    101430570 (MAPK1)
   04350 TGF-beta signaling pathway
    101430570 (MAPK1)
   04370 VEGF signaling pathway
    101430570 (MAPK1)
   04371 Apelin signaling pathway
    101430570 (MAPK1)
   04668 TNF signaling pathway
    101430570 (MAPK1)
   04066 HIF-1 signaling pathway
    101430570 (MAPK1)
   04068 FoxO signaling pathway
    101430570 (MAPK1)
   04072 Phospholipase D signaling pathway
    101430570 (MAPK1)
   04071 Sphingolipid signaling pathway
    101430570 (MAPK1)
   04024 cAMP signaling pathway
    101430570 (MAPK1)
   04022 cGMP-PKG signaling pathway
    101430570 (MAPK1)
   04151 PI3K-Akt signaling pathway
    101430570 (MAPK1)
   04150 mTOR signaling pathway
    101430570 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101430570 (MAPK1)
   04148 Efferocytosis
    101430570 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    101430570 (MAPK1)
   04210 Apoptosis
    101430570 (MAPK1)
   04218 Cellular senescence
    101430570 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101430570 (MAPK1)
   04520 Adherens junction
    101430570 (MAPK1)
   04540 Gap junction
    101430570 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    101430570 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101430570 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101430570 (MAPK1)
   04613 Neutrophil extracellular trap formation
    101430570 (MAPK1)
   04620 Toll-like receptor signaling pathway
    101430570 (MAPK1)
   04621 NOD-like receptor signaling pathway
    101430570 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    101430570 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    101430570 (MAPK1)
   04660 T cell receptor signaling pathway
    101430570 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    101430570 (MAPK1)
   04659 Th17 cell differentiation
    101430570 (MAPK1)
   04657 IL-17 signaling pathway
    101430570 (MAPK1)
   04662 B cell receptor signaling pathway
    101430570 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    101430570 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    101430570 (MAPK1)
   04062 Chemokine signaling pathway
    101430570 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101430570 (MAPK1)
   04929 GnRH secretion
    101430570 (MAPK1)
   04912 GnRH signaling pathway
    101430570 (MAPK1)
   04915 Estrogen signaling pathway
    101430570 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    101430570 (MAPK1)
   04917 Prolactin signaling pathway
    101430570 (MAPK1)
   04921 Oxytocin signaling pathway
    101430570 (MAPK1)
   04926 Relaxin signaling pathway
    101430570 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    101430570 (MAPK1)
   04919 Thyroid hormone signaling pathway
    101430570 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    101430570 (MAPK1)
   04916 Melanogenesis
    101430570 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101430570 (MAPK1)
   04270 Vascular smooth muscle contraction
    101430570 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101430570 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    101430570 (MAPK1)
   04725 Cholinergic synapse
    101430570 (MAPK1)
   04726 Serotonergic synapse
    101430570 (MAPK1)
   04720 Long-term potentiation
    101430570 (MAPK1)
   04730 Long-term depression
    101430570 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    101430570 (MAPK1)
   04722 Neurotrophin signaling pathway
    101430570 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    101430570 (MAPK1)
   04380 Osteoclast differentiation
    101430570 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101430570 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101430570 (MAPK1)
   05206 MicroRNAs in cancer
    101430570 (MAPK1)
   05205 Proteoglycans in cancer
    101430570 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    101430570 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    101430570 (MAPK1)
   05203 Viral carcinogenesis
    101430570 (MAPK1)
   05230 Central carbon metabolism in cancer
    101430570 (MAPK1)
   05231 Choline metabolism in cancer
    101430570 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101430570 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101430570 (MAPK1)
   05212 Pancreatic cancer
    101430570 (MAPK1)
   05225 Hepatocellular carcinoma
    101430570 (MAPK1)
   05226 Gastric cancer
    101430570 (MAPK1)
   05214 Glioma
    101430570 (MAPK1)
   05216 Thyroid cancer
    101430570 (MAPK1)
   05221 Acute myeloid leukemia
    101430570 (MAPK1)
   05220 Chronic myeloid leukemia
    101430570 (MAPK1)
   05218 Melanoma
    101430570 (MAPK1)
   05211 Renal cell carcinoma
    101430570 (MAPK1)
   05219 Bladder cancer
    101430570 (MAPK1)
   05215 Prostate cancer
    101430570 (MAPK1)
   05213 Endometrial cancer
    101430570 (MAPK1)
   05224 Breast cancer
    101430570 (MAPK1)
   05223 Non-small cell lung cancer
    101430570 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101430570 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    101430570 (MAPK1)
   05161 Hepatitis B
    101430570 (MAPK1)
   05160 Hepatitis C
    101430570 (MAPK1)
   05171 Coronavirus disease - COVID-19
    101430570 (MAPK1)
   05164 Influenza A
    101430570 (MAPK1)
   05163 Human cytomegalovirus infection
    101430570 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101430570 (MAPK1)
   05165 Human papillomavirus infection
    101430570 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101430570 (MAPK1)
   05135 Yersinia infection
    101430570 (MAPK1)
   05133 Pertussis
    101430570 (MAPK1)
   05152 Tuberculosis
    101430570 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101430570 (MAPK1)
   05140 Leishmaniasis
    101430570 (MAPK1)
   05142 Chagas disease
    101430570 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101430570 (MAPK1)
   05020 Prion disease
    101430570 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    101430570 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    101430570 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101430570 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101430570 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101430570 (MAPK1)
   04934 Cushing syndrome
    101430570 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101430570 (MAPK1)
   01524 Platinum drug resistance
    101430570 (MAPK1)
   01522 Endocrine resistance
    101430570 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dnm01001]
    101430570 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dnm03036]
    101430570 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dnm04147]
    101430570 (MAPK1)
Enzymes [BR:dnm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101430570 (MAPK1)
Protein kinases [BR:dnm01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101430570 (MAPK1)
Chromosome and associated proteins [BR:dnm03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     101430570 (MAPK1)
Exosome [BR:dnm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101430570 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH RIO1 STATB_N Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 101430570
NCBI-ProteinID: XP_023446889
LinkDB
Position
Unknown
AA seq 333 aa
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNINKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKVRTKCLIILSVGILGSPSQEDLNCIINLKARNYLLSL
PHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEA
PFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1002 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcgggcgcgggcccggagatggtccgtgggcaggtgttcgac
gtggggccgcgctacaccaacctttcctacatcggcgagggtgcctacggcatggtgtgc
tctgcttatgataatatcaacaaagttcgagtagctatcaagaaaatcagtccttttgag
caccagacctactgccagagaacactgagggagataaaaatcttactgcgcttcagacat
gagaacatcattggaatcaatgatattattcgagcaccaaccatcgagcaaatgaaagat
gtatatatagtacaggacctcatggaaacagatctttacaagctcttgaagacacaacac
ctcagcaacgaccatatctgctattttctttaccagatcctccgagggttaaaatatatc
cactcagctaatgttctgcaccgcgacctcaaaccttccaacctgctgctcaacaccacc
tgtgatctcaagatctgcgactttggcttggcccgtgtggcagacccggaccatgatcac
acagggttcctgacagagtatgtagccacacgttggtacagggctccagagatcatgttg
aattccaaggtaaggaccaaatgtttaattattttatctgtaggtattcttggatcccca
tcacaggaagacctgaattgtattataaacttaaaagctagaaactatttgctttctctt
ccacacaaaaataaggtgccatggaacaggctcttcccaaatgctgattccaaagctctg
gacttactggataaaatgttgacattcaaccctcacaagaggattgaagtagaacaggct
ctggcccacccgtatctggagcagtattatgatccaagtgatgagcctattgctgaagca
ccattcaagtttgacatggaattggatgacttgcctaaggaaaaactcaaagaactcatt
ttcgaagagactgctagattccagccaggatacagatcttaa

DBGET integrated database retrieval system